Details for Capsella Locus Carubv10009288m

Position : scaf_1 ( 5`- 19175428 .. 19178963 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10009288m

Protein [Map View]
MLKHKILCQKETKKPLNKLVPEKHKSKGISSEVEASSLKSRSIRSETDGGTLSMNCSSIKRYQRLNLRSSPNGLCRERRD
ENLLNSSLLRRSSPPSFVHRLKKLDSMRGRSYTPSPPRGYGRRGRSPSPRGRYGGRSRDLPTSLLVRNLRHDCRQEDLRR
SFEQFGPLKDIYLPRDYYTGDPRGFGFVQFEDPADAADAKYHMDGYLLLGRELTVVFAEENRKKPTEMRLRERGGGRCME
LSLFELFCLSSNIIKFLTFSVSRSSRFRDRRRTPPRYYSRSRSPPPRRARSRSRSGGYYSPARRHHPRSISPREERYDGG
RSYSRSPAYNGSRGRSVSPARGKSRSISLSPRRSISPSPRRSISRSPRRSRSRSPRRNRSLSPKRSRSNTPDPARSRSQS
PHGGLDDEDRSPSQ*

DNA
ATGCTTAAACACAAAATACTGTGCCAAAAAGAGACAAAAAAACCCCTTAATAAATTGGTACCTGAAAAACACAAATCCAA
AGGGATTTCGTCGGAAGTAGAAGCCTCCTCGCTCAAAAGCCGATCAATTCGCTCTGAAACAGACGGTGGAACCCTAAGTA
TGAACTGTTCTTCCATCAAAAGGTATCAACGGCTTAACTTGAGATCTTCGCCGAATGGATTATGCAGAGAGAGACGAGAC
GAGAATCTATTGAACTCATCGCTTCTTCGTCGTTCGTCACCACCGAGCTTTGTCCACAGGTTGAAGAAGCTTGATTCGAT
GAGAGGAAGGAGCTACACACCGTCACCACCAAGGGGTTATGGGAGGAGGGGTCGAAGCCCAAGCCCTAGAGGCCGATATG
GAGGTCGTAGCAGGGACCTCCCCACCAGTCTTTTGGTTCGCAATCTACGCCATGATTGCAGGCAAGAAGATCTCAGGAGG
TCATTTGAGCAGTTTGGTCCACTCAAAGACATTTACTTGCCAAGGGATTACTATACTGGAGATCCACGAGGGTTTGGATT
CGTTCAGTTTGAGGACCCTGCTGATGCTGCTGACGCAAAATATCACATGGATGGGTATCTTCTTCTTGGCCGGGAATTGA
CTGTTGTGTTTGCAGAAGAGAACAGGAAGAAACCCACTGAAATGAGGTTAAGGGAGCGTGGTGGAGGAAGGTGCATGGAG
CTTTCTCTTTTTGAACTGTTCTGTTTATCATCAAATATCATTAAGTTTTTAACATTTTCTGTTAGTAGGAGCAGCAGATT
TCGGGATAGAAGGCGTACTCCCCCTCGCTACTACTCTCGCTCCCGTTCTCCTCCCCCTCGACGTGCTAGATCTCGGTCAC
GGAGCGGTGGCTATTATTCTCCCGCTAGGAGACATCATCCAAGGTCTATCTCGCCCAGGGAAGAACGATATGATGGGGGA
AGATCATACTCTCGCTCACCAGCCTATAATGGCTCAAGGGGTCGCAGTGTAAGTCCAGCCAGAGGTAAGAGCCGCAGCAT
AAGCCTCAGCCCTAGAAGAAGCATAAGCCCCAGCCCTAGAAGAAGCATAAGCCGTAGCCCAAGAAGAAGCAGGAGCCGGA
GCCCGAGGAGAAATAGGAGCTTGAGCCCAAAAAGAAGCAGAAGCAACACTCCTGACCCAGCCAGAAGCAGGAGCCAGAGC
CCGCATGGAGGGCTAGATGATGAAGATCGTTCACCAAGCCAGTGA