Details for Capsella Locus Carubv10009220m

Position : scaf_1 ( 5`- 19171081 .. 19172789 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10009220m

Protein [Map View]
SFCVRSFSTLKVPRSISSSLCRAVWHFSCTARVATAMATESFCLKPVPFARFTTNQFNQFPKRIKLSCRIRRYRFGVICS
KSSDYQDFQSYARPLRLLPVEEVKLCRGNPSFTVSETRSLYKVKLQTSNLFGSGISDMNARVLLCLIDEKGDSVLQTIPA
NFSSLDPEVVENGETFKFQRGSVDEFTFEGPKLGKIRAFWIGLESGQWRVGGVNLWVVNPRAKETDAETFCYRYDFEVDE
ILLGESSELSMVELKPIRITELTDSDQISSSTALDLDRTTVSNEESMEEYANLKLSLLLYDAILILLGSSAFAFSLGENS
AIAFFFGGTMGFLYLLLLQRSVDELQAPGSSSSENSNQTLSQGLKIPVLTLALAIGLTVLAMRGPIGGDFTAFAVTPKEI
LVGTLGFLVCKVAVVLAAFKPLKDGS*

DNA
TCTTTCTGTGTTAGAAGTTTCTCTACCTTGAAGGTTCCTCGGTCAATCTCTTCTTCTTTGTGCCGTGCCGTGTGGCATTT
CTCATGTACCGCGAGAGTTGCAACAGCAATGGCGACGGAATCATTTTGTCTGAAGCCCGTACCTTTCGCAAGGTTTACGA
CGAACCAATTCAATCAATTTCCTAAAAGAATAAAACTTTCATGTCGAATTCGTCGTTATCGATTCGGTGTCATTTGCTCG
AAGTCATCTGATTACCAAGATTTTCAGAGTTATGCAAGACCTTTGCGTCTCTTACCAGTAGAAGAAGTGAAACTTTGTAG
AGGGAACCCATCTTTCACTGTGAGCGAAACTCGATCTCTTTATAAGGTTAAGCTGCAGACAAGTAATTTGTTTGGTTCGG
GGATTAGTGACATGAATGCTAGGGTTCTTCTTTGCTTGATAGACGAAAAGGGTGATTCGGTGTTACAGACAATACCTGCA
AATTTTTCATCTTTGGATCCAGAAGTTGTGGAAAATGGTGAAACCTTCAAGTTTCAGAGAGGCTCTGTTGATGAATTCAC
ATTTGAAGGACCAAAACTCGGCAAAATCAGAGCTTTTTGGATCGGTCTTGAGTCTGGTCAATGGAGAGTTGGAGGAGTGA
ACTTGTGGGTGGTTAATCCTCGGGCTAAAGAAACCGATGCAGAAACCTTTTGTTACCGATACGATTTTGAAGTTGATGAA
ATCTTGCTTGGAGAGAGCAGTGAACTATCAATGGTGGAGCTAAAACCTATCCGTATCACTGAACTCACGGACTCCGATCA
AATCTCTTCATCTACAGCTTTGGATCTTGACCGTACAACGGTATCCAATGAGGAAAGCATGGAAGAATATGCAAACTTGA
AACTCTCTCTGCTTCTCTACGATGCCATTCTCATCCTTCTTGGAAGTTCGGCCTTTGCTTTCTCACTAGGCGAAAATTCC
GCCATTGCTTTCTTCTTCGGTGGAACAATGGGATTTCTCTACTTGCTGCTCCTACAGAGATCAGTTGATGAACTGCAAGC
ACCGGGATCTTCTTCATCCGAAAACTCCAATCAGACACTAAGCCAAGGACTCAAGATTCCGGTTTTGACTCTCGCATTGG
CCATAGGATTGACGGTTTTAGCCATGAGAGGTCCCATTGGGGGAGATTTTACTGCATTTGCAGTCACACCAAAAGAGATA
TTGGTGGGGACTTTGGGGTTTCTTGTATGCAAAGTAGCCGTTGTTTTGGCTGCGTTTAAGCCCTTGAAGGATGGTTCTTA
A