Details for Capsella Locus Carubv10009185m

Position : scaf_1 ( 5`- 19165067 .. 19168000 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10009185m

Protein [Map View]
MDLSSQRQSPNGSRGFRLQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRKNSKRERTRIQPPLLP
GLPDDLAVACLIRVPRAEHRKLRQVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKISWNTFDPSSQIWQPLPP
VPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRRVIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQ
RTLRSAEVYDPNKNRWSFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPCTSLN
GRLYGLDCRDGCKLRVFDETADSWNKFMDSKVHLGNSKSLEAAALVPLNNKLCIIRNNMSMSLVDVSNPDKNNPRLWENI
AVKGQSKNILSNIWSSIAGRALKSHIVHCQVLQA*

DNA
ATGGATCTATCTTCTCAACGTCAATCCCCAAATGGTTCTAGGGGTTTTCGTCTCCAAGCTCCATTGGTGGATTCTGTTTC
TTGCTATTGTAGAGTGGATTCTGGTCTTAAGACAGTAGTAGAAGCGAGGAAGTTTGTTCCTGGATCAAAGCTTTGTATTC
AACCTGATATCAATCCCAATGCTCATAGGCGTAAGAATTCTAAGAGGGAGAGGACTCGAATCCAACCTCCTCTTCTCCCT
GGCCTCCCTGACGATCTTGCTGTTGCTTGCCTCATCCGTGTCCCTCGTGCTGAGCATAGAAAACTCAGGCAGGTGTGTAA
GCGATGGTACAGGCTTGCTTCTGGCAACTTCTTTTACTCTCAGAGGAAGCTACTTGGGATGTCCGAGGAATGGGTTTATG
TTTTTAAGAGAGATCGCGACGGGAAGATCTCGTGGAATACGTTTGATCCAAGCTCTCAGATTTGGCAGCCGCTTCCACCA
GTTCCCAGAGAGTATTCAGAGGCTGTTGGGTTTGGTTGCGCTGTTTTGAGCGGTTGTCATCTTTATTTGTTTGGAGGTAA
AGATCCTCTTAGAGGGTCCATGAGAAGGGTTATTTTCTACAATGCAAGGACGAATAAGTGGCACAGGGCACCCGATATGC
TTAGGAAGCGCCATTTCTTTGGTTGTTGTGTCATTAACAACTGTTTATATGTTGCGGGTGGGGAGTGTGAAGGGATTCAG
AGGACACTCCGCTCAGCTGAGGTTTATGACCCAAACAAGAACAGGTGGAGTTTTATTGCTGATATGAGCACAGCAATGGT
GCCTCTTATCGGTGTGGTCTATGATAAAAAGTGGTTTCTCAAGGGTCTTGGGTCTCACCAACTAGTCATGAGTGAAGCTT
ATGACCCCGAAGTTAACTCATGGAGCCCGGTTAGTGATGGGATGGTTGCTGGTTGGCGAAATCCATGTACTTCTCTGAAT
GGTCGCCTTTACGGACTGGATTGTAGGGACGGATGCAAACTCAGGGTATTTGATGAAACCGCGGACTCATGGAACAAATT
CATGGACAGTAAAGTTCATTTGGGAAACTCAAAGTCGCTTGAAGCTGCGGCTCTTGTTCCTCTAAACAATAAGCTTTGTA
TAATCCGGAACAACATGAGCATGAGTCTGGTTGATGTCTCGAATCCAGACAAGAACAACCCTCGACTGTGGGAAAACATA
GCCGTAAAAGGACAGTCCAAGAACATCCTCAGTAATATATGGTCGAGTATCGCAGGGAGAGCTTTGAAGAGCCATATTGT
GCATTGTCAAGTGCTTCAAGCTTGA