Details for Pigeonpea Locus C.cajan_23658

Position : sca11 ( 5`- 1165857 .. 1162667 -3` )
Annotation :
External links : CoGe
PGDD synteny : C.cajan_23658

Protein [Map View]
MFPSQRLGFRFFSSKFDKGFAQKVLDKPAAAVTSAFSRYREAIGLQIEAFFKRNHLFLFGAAGVVFCAILWRILFGVANL
FVSLSEGMAKYGFLALSSAIVAFTGLYIRSRLTINPDKVYRMAMTRLNTSAGILEVMGAPLSGTDLRAYVMSGGGLTIKK
FKPSIRGRRCFLIFPIRGSEQKGLVSVEVKKKKGQYDMKLLAVDVPMATGPDQRLYLIGDEEEYRVGGGLISVLRDPVVK
AMAATKEFDDLDEVEEEEDAEKERLESERKQREEIEKLEKSGT

DNA
ATGTTCCCCTCGCAGCGCCTTGGCTTCCGATTCTTCTCCTCGAAATTCGACAAAGGTTTTGCGCAGAAGGTGTTGGATAA
ACCTGCAGCTGCAGTGACATCTGCTTTCTCGCGTTACCGCGAGGCAATTGGGTTGCAAATCGAGGCATTCTTCAAGAGGA
ACCATCTCTTTCTGTTTGGCGCTGCTGGAGTCGTCTTTTGCGCTATTCTGTGGAGGATCCTCTTCGGAGTCGCTAACCTC
TTCGTTTCACTCTCCGAAGGCATGGCCAAGTATGGCTTCCTCGCCCTTTCATCTGCTATCGTTGCTTTTACTGGCTTGTA
TATTCGCTCGAGGTTAACAATCAACCCTGATAAAGTTTATAGAATGGCTATGACGAGGCTTAACACCTCTGCTGGGATTC
TTGAAGTTATGGGTGCCCCCCTTTCTGGAACTGACTTGAGAGCCTATGTCATGTCAGGAGGTGGCCTCACCATCAAGAAA
TTCAAGCCAAGTATTAGGGGCCGTCGATGTTTTCTCATTTTCCCCATTAGAGGCTCTGAGCAAAAGGGGCTAGTCAGTGT
CGAAGTCAAGAAAAAGAAGGGTCAGTATGATATGAAGCTGCTGGCCGTTGATGTTCCTATGGCTACTGGTCCAGACCAGC
GGTTGTATTTAATTGGGGATGAAGAAGAGTACAGGGTTGGTGGGGGACTAATATCTGTGCTAAGAGATCCTGTAGTGAAA
GCAATGGCAGCAACCAAGGAATTTGATGATCTTGATGAGGTTGAGGAAGAGGAGGATGCTGAAAAAGAACGTCTGGAATC
TGAAAGAAAGCAGCGTGAAGAAATTGAAAAGCTCGAAAAGAGTGGCACCTAG