Details for Pigeonpea Locus C.cajan_23650

Position : sca11 ( 5`- 1077864 .. 1075806 -3` )
Annotation :
External links : CoGe
PGDD synteny : C.cajan_23650

Protein [Map View]
MSILFPPTSSAKGKRLIRELVQGQDYATQLKFLLQNPIGPRGFLSAKELVSNVLRSFSQTLSVLTSSDDDDHVSQNLGED
ASQLVASSINPRSEDSTESRKGSLPLAKDRRGSYKRRRTEQTWTIVSQTNDDNHAWRKYGQKEILNSQFPRSYFRCTRKY
EQGCRATKQVQRIQENPDMYNITYIGFHTCKDTLNLNAPQLVTYSETRDSFLENSHPHSNIVSNEQQHDPPMGSQSTTNV
KQEYPNEDTPSDLTDANLWSDLKDFELSNALKIASDNADIGYSCTASRSLDMDFGMFCSHFSSDFNFDENHFV

DNA
ATGAGTATTCTCTTCCCTCCCACTTCCTCAGCCAAGGGGAAAAGGCTCATCAGAGAACTTGTTCAGGGTCAGGATTATGC
CACTCAGCTCAAGTTTCTGCTTCAGAACCCTATTGGGCCTCGTGGCTTCCTTTCTGCTAAGGAACTAGTGTCTAATGTTC
TCAGATCTTTCTCTCAGACTCTCTCTGTCTTGACTTCTTCTGATGATGATGACCACGTTTCTCAGAATCTCGGAGAAGAT
GCCTCGCAGCTTGTGGCTTCCAGCATTAATCCGAGGTCTGAGGATTCCACTGAGAGTAGGAAGGGATCATTGCCCCTTGC
AAAGGATCGGAGAGGGTCCTACAAAAGAAGGAGGACTGAACAGACATGGACCATTGTTTCTCAAACAAATGATGATAATC
ATGCATGGAGAAAGTACGGACAAAAGGAGATCCTAAATTCTCAATTTCCCAGGAGTTACTTTAGGTGCACTAGGAAGTAT
GAACAAGGTTGCCGAGCAACGAAACAGGTGCAACGGATACAAGAGAATCCTGACATGTATAATATTACTTACATTGGCTT
TCACACATGCAAAGACACCCTCAACCTCAATGCTCCACAATTGGTCACATATTCTGAAACTCGAGACTCATTTCTCGAGA
ATTCTCATCCTCATTCAAACATTGTGTCAAATGAACAACAACATGATCCTCCTATGGGATCACAAAGCACAACAAATGTA
AAACAAGAATATCCCAACGAGGACACTCCCAGTGATCTTACAGATGCTAACCTGTGGTCTGATTTGAAGGATTTTGAACT
ATCCAATGCCTTGAAAATAGCATCTGATAATGCAGATATTGGGTATTCATGTACTGCCTCTCGGAGTCTGGACATGGATT
TTGGGATGTTTTGTTCTCATTTCAGCTCCGATTTCAACTTTGATGAAAACCATTTTGTTTAG