Details for Pigeonpea Locus C.cajan_23645

Position : sca11 ( 5`- 1008350 .. 1005334 -3` )
Annotation :
External links : CoGe
PGDD synteny : C.cajan_23645

Protein [Map View]
MKNLRSVSVARNRMTGSVPDGFGSCLLLRSIDLGDNSFSGSIPGDFKELSLCGYLSLRGNAFSGEVPEWIGEMRGLETLD
LSNNGLTGQVPKSIGNLQSLKMLNFSGNGFTGNLPESMASCTKLLTLDVSRNSLSGWLPLVKSPLFALAEVSVQSLQVLD
LSHNAFSGEITDAVAGLTSLRVLNLANNSLRGPIPAAVGELKTCASLDLSYNKLNGSIPWEIGGAVSLKELVLERNFLIG
KIPTSIENCSMLTTLILSQNRLSGQIPGAVAKLTNLQTVDLSFNNLTGTLPKQLANLANLFSFNLSHNNLQGELPAGAAV
IVIGVISITVLNLRVRSSESRDAAAIAFSAGDEFSHSQTTDANSGKLVMFSGEPDFSSGAHALLNKDCELGRGGFGAVYQ
TVLRDGHSVAIKKLTVSSLVKSQEDFEREVKKLGKIKHQNLVELEGYYWTPSLQLLIYEFVSGGSLYKHLHEGSGGNFLS
WNERFNVILGTAKALAHLHHSNIIHYNIKSTNVLLDSYGEPKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTV
KITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVP
SNRPDMGEVVNILELIRCPSEGQEELG

DNA
ATGAAGAATTTGAGGAGTGTTAGCGTGGCGAGGAATCGGATGACCGGGAGTGTTCCCGATGGGTTTGGGAGCTGTTTGCT
TTTGAGGTCCATTGATTTGGGGGATAATTCCTTTTCTGGGAGCATTCCTGGTGATTTTAAGGAGCTTTCATTGTGTGGTT
ACCTTAGTTTGCGAGGAAATGCTTTCTCAGGAGAGGTTCCTGAGTGGATTGGAGAGATGAGAGGGCTTGAGACGTTGGAC
CTTTCCAACAACGGGTTGACTGGTCAGGTGCCCAAGTCAATTGGGAATCTTCAGTCGTTGAAGATGTTGAATTTTTCAGG
AAATGGTTTCACTGGTAATCTGCCAGAGTCAATGGCGAGTTGCACCAAGCTTTTGACGTTGGATGTCAGCCGGAATTCGT
TGTCCGGATGGCTTCCATTGGTGAAAAGCCCTTTGTTTGCCTTGGCTGAAGTCTCGGTTCAAAGTCTTCAAGTGTTGGAT
TTGTCTCACAATGCATTTTCTGGTGAAATCACAGATGCTGTTGCAGGTCTAACCAGCTTGCGGGTTTTGAATTTGGCAAA
TAACTCTCTTAGAGGTCCTATACCAGCTGCAGTTGGTGAATTGAAAACATGTGCTAGTCTTGATCTGAGCTATAATAAGC
TGAATGGAAGCATACCTTGGGAAATAGGAGGAGCTGTGTCCTTGAAAGAACTGGTATTGGAAAGGAACTTCCTAATTGGG
AAAATTCCAACTTCAATTGAGAACTGCTCTATGCTAACAACTCTGATTCTGTCCCAGAACAGGCTGAGTGGCCAAATACC
TGGCGCAGTTGCAAAACTTACCAACCTGCAAACTGTGGACTTATCATTTAACAACCTTACTGGGACCCTTCCTAAGCAAT
TGGCCAACCTTGCCAATCTTTTTTCATTCAATTTATCTCACAACAACCTTCAGGGTGAACTGCCGGCTGGTGCTGCTGTC
ATTGTAATTGGTGTTATTAGCATCACTGTTCTCAATCTCCGTGTTCGCTCCTCTGAATCCCGGGATGCAGCTGCCATTGC
ATTTTCTGCAGGGGATGAATTCAGCCATTCCCAAACTACAGATGCCAACTCTGGCAAGCTTGTTATGTTTTCAGGTGAGC
CTGATTTTAGTTCAGGTGCGCATGCTTTGCTTAATAAGGATTGTGAGCTTGGGCGTGGAGGATTTGGTGCAGTGTACCAA
ACGGTTCTCAGAGATGGGCACTCAGTTGCTATAAAGAAGCTCACTGTATCAAGCCTTGTCAAGTCTCAAGAAGATTTTGA
AAGAGAAGTGAAGAAATTAGGAAAAATCAAACACCAAAACCTTGTGGAACTTGAGGGTTATTATTGGACACCATCACTGC
AGCTCCTCATATACGAGTTTGTCTCTGGTGGTAGTCTCTATAAGCATCTTCATGAAGGATCCGGTGGAAACTTCCTCTCA
TGGAATGAGAGATTTAATGTGATTCTTGGAACCGCAAAGGCCTTGGCACACTTGCACCATTCCAACATTATTCACTACAA
CATTAAGTCAACCAATGTCCTTCTTGATAGCTATGGTGAACCAAAAGTAGGGGATTTTGGCCTAGCGAGGCTGTTGCCAA
TGCTTGATCGATACGTTCTGAGCAGCAAAATTCAGAGCGCACTTGGCTACATGGCACCAGAGTTTGCCTGCAAAACGGTG
AAAATCACCGAAAAATGTGATGTATATGGGTTTGGTATCTTGGTCTTGGAGATTGTTACTGGGAAGAGGCCTGTTGAATA
CATGGAGGATGACGTGGTGGTGCTTTGTGACATGGTTAGAGGGGCGTTGGAAGAAGGCAGGGTGGAGGAATGCATTGATG
AGAGACTCCAAGGGAAGTTCCCAGCAGAAGAAGCTATTCCTGTGATGAAACTAGGCTTAATATGTACTTCTCAAGTGCCA
TCTAATAGGCCTGACATGGGAGAGGTAGTTAACATATTGGAGCTGATAAGATGTCCCTCTGAAGGACAAGAAGAATTGGG
ATGA