Details for Sugar beet Locus Bv7_156030_oqxr

Position : Bvchr7.sca ( 5`- 465374 .. 469418 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bv7_156030_oqxr

Protein [Map View]
MLVKFPFFVVLLLIIPSVVLCLDAFNDDVLGLIVFKAGVKDPDAKLVSWNESDDKPCKWNGVKCDPTTNRVTEITLDGFS
LSGQISRSLLRLQFLQKISLSNNNLSGTVNPEFAHLWNLQSIDLSGNNLSGFIPNELFQQCGSLKSVSFANNVLSGELPD
SLSSCMTLQSVNFSSNRISGKLPKKIWSLNGLQSLDLSNNLLGGQIPLGFGEMYSLKVISLGKNAFSGLLPEDIGSCLQL
QSVNFGENSFSGVIPESLQKLNMCTSVSLNGNLLSGEVPDWFGHMESLENLDLSVNKFFGRIPFTLGNMRSLKELNLSSN
GITGGLPQSLMNCDNLLSLDVSFNLLKGKMPNWIFELGLQKFSLSGNKFKGIIDFPPLRTNALSYERLQFLDLSSNVLSG
VVPSEIGAFKGLQFLNMSSNSFTGSIPRSVGDLNLAQVIDLSYNRFNGSIPSEIGGALALRELRLEGNRLSGHIPAQIEN
CSFLTALILSENNLTGPIPPTIAKLVNLEIADLSHNNLSGNLPKELTGLSHLVAFNISNNNLEGELPAGGFFDNIPLTSV
FNNPSLCGSVVNQSCPAVHPKPIVLNPNPSTDSEDDSFPPNTRHKKLVLSVSALIAIGAAAFIFLGVVIISLLNLHVRNS
SHRSAAPLEFFGKDEFSHSQTSDSQYGKLVMFSGEADFGTGAHALLNKDSELGRGGFGVVYHTVLGDGRSVAIKKLNISS
LIKSQEEFEREMKKLGKVRHHNLVTLEGYYWTPSLQLLINEYVPGGSLFKHLHEEPSRTPLSWHQRFNIIVGVAKGLAHL
HQIDIIHYNLKSSNILIDSSDEAKVGDFGLARLLPMLDRYILSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEV
VTGRKPVEYMEDDVVVLAEMVRGALEEGKSEDCIDQRLHGNFIAEEVIPVIKLGLICASQVPSNRPEMAEVVNILELIQC
PSEGRDEEIEQV

DNA
atgcttgtgaaatttcccttctttgttgttcttctgttaataataccctctgttgtgctgtgtttggatgctttcaatga
tgatgttcttgggttaatagtgtttaaggcaggtgttaaagacccagatgctaaattagtgtcttggaatgagagtgatg
ataaaccttgcaaatggaatggtgtcaaatgtgatccaactactaacagggttactgagattactcttgatggtttttca
ctttctgggcagattagtagaagtcttctgaggttgcaatttcttcaaaaaatatcactatctaacaataatctttctgg
gactgtaaaccctgaatttgcccacctttggaacttgcaatctattgatttaagtggaaataatctatctgggtttattc
ctaatgagctttttcaacaatgtgggtctctaaaatcagtttcttttgccaataatgtgttatctggtgaattaccagat
tctttgagctcctgtatgacattacagtctgttaacttctcctcgaatcgaatttcgggtaagttgcctaaaaagatttg
gtctttgaatggtcttcaatctcttgatttgtcaaataatctgttgggaggtcagattcctctagggtttggggaaatgt
acagtttgaaggtgatcagtctaggaaagaatgcattttctgggcttttaccagaagatattggtagctgtttacagtta
cagtcagtaaattttggtgaaaactcattttctggggtaattccagaatcattacaaaagcttaatatgtgtacttcagt
aagcttaaatgggaatttactcagtggtgaagttcctgattggtttgggcatatggaaagccttgaaaatttggatcttt
cagtgaataaattttttggaaggattccatttactttaggaaatatgagatcattgaaggaattgaatttatcttccaat
ggaattacaggtggattacctcaatctttgatgaactgtgataaccttttgtctcttgatgttagcttcaacttattaaa
agggaaaatgccaaactggatttttgagttgggtttgcagaaattctcattgtctggcaataaattcaaaggcattattg
attttcctcctttaagaacaaatgcactttcttatgagagacttcagttcttggacttatcttcaaatgtgttatctggt
gttgttccatctgagattggggctttcaaaggcttgcaattcttgaatatgtctagcaactcgttcacgggttcgattcc
aagaagtgtgggtgacttgaatttggctcaagttattgatctgagttacaataggtttaatggaagcattccttcggaaa
tcggaggcgcactcgcactgagagagctaaggcttgaaggaaaccggttatctgggcatatcccagctcagattgaaaac
tgctcattcttgacagcattaatcctttcagagaacaacctcacaggccctatacctcctacaatagcaaaactggttaa
ccttgaaattgctgatttgtcccataacaatctctctggtaatttaccaaaggaactcaccggtctttcccacttagttg
cctttaacatctcgaacaacaaccttgaaggggaacttcccgcgggtggtttctttgataatattcctctcacatctgtc
tttaacaatccatccctatgtggatcagttgttaatcagtcttgtcctgcagtgcaccctaagcccattgttctcaaccc
aaacccatcaactgattctgaagatgactccttccctccaaatacccgtcacaagaagctcgtgcttagtgtttctgctc
taatagccattggtgctgctgcattcatcttccttggtgtggtgataatttctctcctcaacctccatgttaggaactct
tctcatagatcagcagcccccctagaattctttggcaaggatgagttcagccattctcaaacaagtgattctcaatatgg
aaaacttgttatgttctctggtgaagctgattttggaactggggctcatgctctcctcaataaggactctgagctaggtc
gtggtgggtttggagtggtttaccatacggttcttggagatgggcgttcagttgcaatcaagaagctcaacatctcaagc
ttaataaagtctcaagaagagttcgagagggagatgaagaagctcggaaaagttaggcaccataatcttgtgactttaga
agggtattactggaccccgtctttgcaactcttgatcaatgaatatgttccaggcggaagtttgtttaagcacctccatg
aagaacccagtagaactcccctctcctggcaccagaggttcaatataattgttggggtggcaaagggtttagctcatttg
catcaaattgatataattcactataacctgaaatcctcaaatattttgattgattcctctgatgaagctaaggttggaga
ctttgggttagcgaggttgttgcctatgctagaccgttacatcttgagcagtaagattcagagtgcacttgggtacatgg
cacctgaatttgcctgcaaaaccgtcaagataacagaaaagtgtgatgtttatggttttggaatattagtacttgaagtt
gtgaccggaagaaagcctgtcgaatacatggaggatgatgttgttgtgctcgctgagatggttagaggagcactcgagga
aggcaagtcagaggattgtatcgatcagagacttcatgggaattttatcgcagaggaggttattccagtgattaagctcg
gtttgatatgcgcttctcaagttccatcaaatcgacctgaaatggcagaagtggttaatattttggagctcatccaatgt
ccttctgaaggacgagacgaggagatcgaacaggtttag