Details for Sugar beet Locus Bv7_155950_hqwy

Position : Bvchr7.sca ( 5`- 390274 .. 393089 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bv7_155950_hqwy

Protein [Map View]
MKQGQESAQQIRSFFHGKLGLLKVEDDIVCDDNNHHQNDVNHHSLVTLESFEKCLNLLKTYDFDHQSYDLNRKRKISSIH
DLKCPKSEDISGGTLPKERRGSYKRRRTGQSWTVEATNLTDDGYAWRKYGQKEILNTKYPRNYYRCTHKHDQECQATKQV
QQISENPNKYNIIYHGTHTCKNHHNNPTIIMESPEENSSIFLSFETNNYTTAKHGLNTSLFPSSTTNTTTIKQEYTSIKV
DSPCGPHDLDHQLSGTHNQYSSSSDVPSCSDLTSTGLSSTPVSDQSDVISSTEIYSSTPTSCDIGQDYAHLFFEEYYTNL
EELFSYP

DNA
atgaaacaaggtcaagaatcagctcaacagataagaagtttctttcatggaaagctaggattattgaaagttgaggatga
tatagtatgtgatgataataatcatcatcaaaatgatgtaaatcatcattcattggtgactttggaatcatttgaaaagt
gtcttaatttgcttaaaacttatgattttgatcatcagagttatgatcttaacagaaagcgtaaaattagttccattcat
gatcttaaatgcccaaagtctgaggatattagtggtggaacacttcctaaagaaagaaggggaagctacaaaagaaggag
gactggccaatcatggactgtggaggctacaaatctaacggatgatggttatgcttggaggaaatatggacaaaaagaaa
ttctcaacacaaagtacccaaggaattactataggtgcacacacaagcatgatcaagaatgccaagcaaccaaacaagtc
caacaaatttcagaaaatcccaacaaatacaacatcatataccatggtactcacacatgcaaaaaccaccacaataaccc
tacaatcataatggaatctccagaagaaaattcctccatctttttaagttttgagacaaacaactacacaacagccaaac
atggccttaacacttccttattcccatcatcaactactaatactactactataaaacaagagtacacttccatcaaggta
gactcaccttgtggaccacatgatcttgatcatcaattatctgggacccacaatcagtattcttcatcatctgatgtacc
atcatgctctgatctaacaagcacaggattatcatcaacacctgtttctgatcaaagtgatgtaatctcttcaactgaga
tttactcctctacacctacttcatgtgatataggtcaagattatgctcatcttttttttgaggaatattatactaatcta
gaagaattgttttcatatccatga