Details for Sugar beet Locus Bv6_152840_mnrw

Position : Bvchr6.sca ( 5`- 2180270 .. 2185965 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bv6_152840_mnrw

Protein [Map View]
MKFGKEYKMQMVPEWVEAYMDYNGLKRILREIRMCQAPRTPRTPLRSLQQRFSMYSPFRGVEVDPRGRQNAGDIEDQVIK
VSPIVGECNRTFYRTRLLLPSEELGGQDEVKFFKKLDEELNKVNAFYRDKVDEVVEEAAALKKQMDAYIALRIKVQNPNI
KGSDVEVAMEPLRVGTQEAPSSDNTSGGREITSPCDDGSDPLGFLSHVKINNTHQGPISVIRGILGESKEKELSFSKDEL
KQVEERLKVVFTEFYQKLRLLKNYSFINLSAFAKIMKKYEKTTLRYAARSYMKIVDKSYLGSCDEIMKLIKEVEHSFVKH
FFNANRREGMKPLRPTKRREKHRVTFISGFFSGCSIALVIAVILMVRARRIMEKGQGSLYMENMFGLYSLSLYIVLHMLM
YAADIYLWKRYQVNYPFIFNFKQGTELGYREVFLLSSGLAVLALACFLANFNMLIGLTVTESMNYAKLIPLLVLLVSLGI
TFCPFNIIYRSSRYFLIKCLFRCVCAPFYEVTLPDFFLADQITSQIQAIRTIEFYICYYSQRGFLEGQSKCHHNGAYNAF
YFVIAIIPYWIRCFQCLRRLVQERDYVHGYNALKYLTAIVAVVMRTVYELKNGTPWLVMALLTSAMAVAYNIYWDIVMDW
GLLRRNSKNFFLRDRLLVSHKSVYYFAMVINVLLRAAWLQLVLEFNVKGLRKTAISTTISCLEIIRRGIWNFFRLENEHL
NNVGKFRAFRSVPLPFNYHDRHDAGDDEYDDEKDD

DNA
atgaagtttggaaaggagtacaagatgcaaatggtgcccgagtgggtagaggcgtacatggactacaatggattaaagag
gatattgagggaaatccgtatgtgtcaagccccaagaacgccacgaacacctttgagaagcttgcagcagcgattctcaa
tgtatagtccttttagaggggtagaagtagatcccagaggtcgacaaaatgctggggatattgaggaccaagtgattaag
gttagtcccattgtaggagagtgtaacaggacgttctataggacgaggctgctcttgccatcagaagaattaggtggaca
ggatgaagttaagtttttcaaaaaacttgatgaggagctcaacaaggtcaatgctttttatcgggataaggttgatgaag
ttgtagaagaagcagctgcattgaagaagcaaatggatgcttatattgccttgcgaattaaggtgcaaaatcctaatatt
aaaggttctgatgtagaagttgctatggaacccttaagagtgggaactcaagaagcaccttcttcagataacacaagtgg
tggcagggaaattacaagtccgtgtgacgatggatcggatcccttggggttccttagtcatgtgaagatcaataacacac
atcaaggtccaatatctgtgatacgaggaattctgggagaatccaaggagaaagagttgagttttagcaaggatgaattg
aaacaagttgaagaacgactaaaagttgtctttacagaattctatcaaaaacttcggcttctaaagaactacagtttcat
aaacctctcagcatttgccaagattatgaagaagtatgagaagaccacgctaaggtacgcagctcgatcatacatgaaaa
tcgtggacaagtcttacctggggagctgcgatgagattatgaaactcataaaggaagtagaacactcatttgtcaagcac
ttctttaatgctaatcgaagagaaggcatgaagcctctgagacccacaaaacgaagagaaaagcacagagtaacattcat
ttcaggcttcttttctggctgctcaattgcacttgttattgccgttattcttatggtgcgagcaaggagaattatggaga
aaggacaaggatccctttacatggaaaacatgttcggactgtacagcttatctttgtatatagttctacatatgctcatg
tatgctgcagacatatacttatggaaacggtatcaagtcaattatccatttatattcaattttaagcagggaacggaact
gggttatcgagaagttttccttctcagcagcggacttgcagttttagcccttgcttgttttttagcaaatttcaacatgc
ttatcggcttgacagtcacagagagcatgaactatgccaagttgatccccttactagttcttttggtgtctcttggtatc
acattctgtcctttcaatatcatatatcgctcaagtcgatattttctgattaaatgtttatttcgatgcgtatgtgctcc
cttttatgaggtcacacttccggactttttcttggcagaccagataacaagtcagattcaggcaataaggactattgaat
tctacatttgttactacagtcaacgaggtttccttgaaggacaaagcaagtgccaccacaatggagcatacaatgctttc
tatttcgtaatagccattataccatactggatccgttgctttcagtgtcttcgtagattggttcaagaaagagactatgt
acatggatacaatgcactgaagtatcttacggcaatagtggccgttgttatgagaacagtatatgaactcaagaacggaa
caccctggttagtgatggccttgctaacctcagctatggcagtggcatataatatatactgggatattgtgatggactgg
ggactattaagacggaattcgaaaaacttcttcttaagggatagactcttagtttcacacaagagtgtgtactactttgc
tatggttataaatgttctattaagagctgcttggctacagcttgttctagagtttaatgtcaaaggtctacgcaaaacag
caatttcgactactatttcctgcctggaaataattcgtcgtgggatctggaacttctttaggttggaaaatgagcacttg
aacaatgtgggtaaatttagagcttttagatctgttccgcttccgttcaactaccatgatcgacacgatgctggtgatga
tgaatatgatgatgagaaggacgattaa