Details for Sugar beet Locus Bv6_152760_uiqu

Position : Bvchr6.sca ( 5`- 2123353 .. 2126565 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bv6_152760_uiqu

Protein [Map View]
MTVGKYHIVNPNEGIPLPETHKVTVRVTSSYGNNYHTADHVETGQFAFTAAETGDYMACFWTPEHNPSVTVTIDFDWKTG
VAAKDWGSVVKKGSVEVMELELKKLMDTVNSIHEEMFYLRDREEEMQVLNRTTNSRMYWLSFLSLVICLSVAGLQVWHLK
SFFERKKLL

DNA
atgaccgttggaaagtaccacatcgtcaatcccaatgaaggaattccgttgccagaaactcataaagtcactgttcgggt
gacgtcgtcgtatgggaataattatcacacagcagatcatgttgaaacaggacaatttgcgtttaccgcagctgagactg
gggattatatggcgtgcttttggactccagaacataatccttctgttactgtgactatagattttgattggaagactggt
gttgctgctaaagattggggtagtgttgttaaaaagggatcggttgaggttatggaattagagttaaagaagctaatgga
tactgtaaattctattcacgaggaaatgttctaccttcgtgatagggaagaagagatgcaagttttgaacagaacaacta
attccagaatgtattggttgagtttcctctcacttgttatttgcctatccgtcgcgggcttacaagtgtggcacttgaag
agtttctttgagagaaaaaagttgctttaa