Details for Sugar beet Locus Bv6_152730_ryjy

Position : Bvchr6.sca ( 5`- 2098940 .. 2105834 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bv6_152730_ryjy

Protein [Map View]
MSEVFDGYERQYCELSANLSNKCSSASLLSDQEQKQQKLTDIKAGLDEADILIRKMDLEARSLQPNLKAMLLAKLREYKS
GLNNLKREVKRISSPNHDQSAREELLEAGGADAYKTSADQRERLTFSTERLNQSSDRIRESRRTILETEELGVSILQDLN
QQRETLLHSHSKLHEVDSAIDKSKKILTAMSRRISKNKWIFGGVIGVLLLAIIFIIYFKLTH

DNA
atgagtgaggttttcgatggctacgagcgccagtactgtgagctctcggctaacctttccaacaaatgttcttccgcttc
tcttttatcagatcaagagcagaaacagcagaagctgacggatattaaggcaggcctggatgaggctgatatattgatac
ggaaaatggatcttgaagcgagaagcttgcaacctaatttgaaggccatgcttcttgcaaagctgagggagtataaatct
ggcttgaataacctgaaaagagaggtgaagagaatcagttcacccaatcatgatcagtctgcccgtgaagagttgctaga
agctggaggggcagatgcatacaagacttctgcagaccaaagagaaagattgacattttcaaccgaaagattgaatcagt
ccagtgacagaattagggagagtaggagaactatactggagacagaagagttgggtgtttcgattcttcaagatttgaac
cagcagcgtgagaccctcttacattcacactcgaagctgcatgaggtagacagcgccattgacaaaagtaagaagatcct
aactgctatgtcacgaagaataagcaaaaacaaatggatctttggtggagtcatcggtgttcttctcctcgccatcattt
ttatcatatattttaagcttactcactag