Details for Chinese cabbage Locus Brara.I05023

Position : A09 ( 5`- 41728577 .. 41729874 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I05023

Protein [Map View]
MDLRRSSIVLLILSILSPATLSMRYELLSGHTKCISEEIHANAMSVGKYSIVNPNDDHPLPDSHKITVRVTSPQGTAYHE
ADGVSTGQFSLTAVETGDYITCISAVDHKPETMLTIDFDWRSGVHTKDWSNVAKKSQVEMMEFEVKKLFDTVTSIHDEMF
YLRDREEEMQELNRATNTKMAWFSFLSLGVCLSVAGLQFWHLKTFFQKKKLI*

DNA
ATGGATCTTCGCCGGAGCTCAATTGTACTACTAATCCTCTCCATCCTATCTCCAGCGACTCTCTCCATGCGCTACGAGCT
ACTCTCGGGCCACACGAAATGCATCTCCGAGGAGATTCACGCCAACGCAATGTCCGTCGGCAAGTACAGCATCGTAAACC
CTAACGACGATCATCCTCTCCCCGATTCCCACAAGATCACCGTCAGGGTGACGTCACCGCAAGGAACGGCGTATCACGAG
GCGGACGGAGTGAGTACGGGACAGTTCTCGTTAACGGCTGTTGAAACGGGAGATTACATAACTTGCATCTCAGCCGTTGA
TCACAAACCGGAGACGATGCTGACCATTGACTTTGATTGGAGGTCGGGGGTTCATACCAAGGACTGGTCTAATGTGGCTA
AGAAGAGCCAAGTTGAAATGATGGAGTTTGAGGTTAAGAAGCTATTCGACACTGTCACATCTATCCATGATGAGATGTTT
TATCTCAGGGACAGGGAAGAAGAGATGCAGGAACTGAACAGAGCCACAAACACGAAGATGGCATGGTTTAGTTTTCTGTC
GCTTGGAGTTTGTTTATCAGTTGCTGGACTTCAGTTTTGGCACTTGAAGACTTTCTTCCAGAAGAAGAAACTCATCTGA