Details for Chinese cabbage Locus Brara.I05006

Position : A09 ( 5`- 41670059 .. 41670955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I05006

Protein [Map View]
MSTDTEANLLALAAVFRRRIEEGGYLPVNFSSAGGEADEDGETTDRRGSVIQRVVVIRSPVGLEDFLNDDGSGKQGRSPA
SKSSVESMPRVVIGGDKEAGGGGGCSICLEEWSEGDVAAEMPCKHEFHSKCVEEWLGRHATCPLCRYEMPVEEVEGEKKV
GVWIGLSVSTGGRRDGEDGGDSNPRDETEA*

DNA
ATGTCTACGGATACGGAGGCGAATTTACTTGCGTTAGCGGCTGTGTTCCGCAGGAGGATCGAAGAAGGTGGATACTTACC
GGTGAATTTTTCTTCAGCCGGCGGAGAAGCCGACGAGGACGGAGAAACCACCGATCGTCGCGGTTCGGTGATCCAGAGAG
TGGTAGTGATCAGATCGCCTGTCGGACTCGAGGATTTTTTGAACGACGACGGTTCCGGGAAACAGGGGAGATCGCCGGCG
TCGAAATCGTCGGTGGAGAGTATGCCACGTGTCGTGATCGGAGGAGATAAGGAGGCTGGAGGAGGAGGAGGGTGTTCGAT
TTGTCTGGAGGAGTGGTCGGAAGGTGACGTGGCCGCGGAGATGCCGTGCAAGCATGAGTTTCACTCAAAGTGTGTGGAGG
AGTGGTTGGGGAGGCACGCCACGTGTCCGCTGTGTAGGTACGAGATGCCTGTTGAGGAAGTGGAAGGAGAGAAGAAAGTT
GGGGTTTGGATTGGTCTCTCTGTTAGCACCGGTGGAAGAAGAGACGGAGAAGACGGTGGTGATTCGAACCCTCGAGATGA
GACAGAGGCTTAG