Details for Chinese cabbage Locus Brara.I05002

Position : A09 ( 5`- 41660357 .. 41661652 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I05002

Protein [Map View]
MGGKGWFLLKLLMFQGLFTSRLQDPGFDFFYFVLQWPGAYCDTKRACCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPD
SEFDPAEISDLVSTMQTKWPTLSCPSNNGSKFWEHEWEKHGTCSESVMDQHKYFENTLALRDRVNLLQILQDAGINPDDE
FYDLQDIKNAIKDGTGFTPVIHCNKDPDKNSQLHEIFFCVDTSGTEFIECPIIPRDRCPSKLQFAMF*

DNA
ATGGGTGGAAAGGGTTGGTTTCTGCTCAAGCTTCTAATGTTCCAAGGTCTTTTCACTTCACGTCTTCAAGATCCAGGCTT
TGATTTCTTTTACTTTGTTCTTCAGTGGCCAGGAGCCTATTGTGATACAAAGCGTGCTTGTTGCTATCCAACAACCGGTA
AACCAGCGGCAGATTTTGGCATTCACGGTCTGTGGCCTAATTACAACGATGGTTCATATCCATCAAACTGTGATCCCGAC
AGTGAATTTGATCCAGCTGAGATATCGGATCTGGTAAGTACTATGCAAACGAAGTGGCCAACACTATCGTGTCCGAGCAA
CAATGGTTCCAAGTTCTGGGAACACGAATGGGAAAAGCACGGAACGTGTTCCGAATCCGTAATGGATCAACATAAGTACT
TTGAGAATACTCTTGCACTCAGAGATAGAGTCAATCTTCTTCAAATCCTTCAAGACGCTGGAATCAACCCAGACGACGAG
TTCTATGATCTTCAAGATATTAAAAACGCGATAAAAGATGGGACTGGGTTTACTCCAGTAATCCATTGTAACAAAGATCC
GGATAAAAACAGCCAACTTCACGAGATCTTCTTTTGCGTCGATACATCAGGAACCGAGTTTATCGAATGTCCAATTATCC
CTAGAGATAGATGTCCTTCTAAACTCCAGTTTGCTATGTTTTAA