Details for Chinese cabbage Locus Brara.I03899

Position : A09 ( 5`- 35600105 .. 35602590 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03899

Protein [Map View]
MAITTNVLATSNAVKLDAVTVSFISSFPGKLNHFLARRLPQSTTRRVQTSCCYRETSLKAVTLFEMPETETSSVSDGVEI
LRFLKGKNYLVTGAFGFLGKGKTKPKTGFSCCPSKLIFGLMFLFLFFVAVLIEKLLRVSPEIGKIFLLIKSADQESANRR
LYDEIISSDLFKLLKKMHGSSYEAFMKSKLIPVTGDIGEDNLGIESVTSAKISGEIDVIISCAGRTTFDDRYDFALNVNA
LGPGRLLRFGKGCKNLKLFLHFSTAYATGKKEGTILETPLCIGENITCDLNIESELKLASEAVRKLHGNEEIKNLKELGM
KRAQHYGWENTYTFTKAMGESVIHNQRGDLPVVIIRPSVIESSYKEPFPGWLQGIRMSDPIILAYGKGQISDFWGDYKSL
MDIIPVDMVVNATIAAMAKHSRGVSELKVYNVTSSSHANPLRVGELMNLSHQHLCDSPLTETFMELERMKFHSSLEGFTS
SIFNRIAKHERGDADSHTALSMKGKRKLDYFVSLARTYEPYTFFQARFDDTNTKRLIQELSVEEGKMFEFDISGIDWEHY
IVNVHLPGLKRELFTERSR*

DNA
ATGGCAATCACAACAAATGTCCTCGCAACAAGCAACGCTGTCAAATTGGATGCTGTAACTGTAAGCTTCATCTCTTCTTT
CCCTGGCAAACTCAACCACTTCTTGGCTCGACGCTTGCCACAGTCGACGACACGTAGAGTCCAAACGTCTTGCTGTTATC
GTGAAACGTCATTGAAAGCTGTGACTCTGTTTGAGATGCCTGAGACAGAAACAAGTAGTGTCAGTGACGGAGTTGAAATT
TTACGTTTCTTAAAAGGAAAAAACTATCTCGTTACCGGTGCATTTGGGTTTCTTGGTAAAGGTAAGACAAAACCTAAAAC
AGGGTTTTCTTGTTGTCCAAGTAAACTGATTTTCGGACTGATGTTTTTATTTTTATTTTTTGTTGCCGTGTTGATTGAGA
AATTACTGCGGGTAAGTCCTGAGATTGGGAAGATCTTCCTTCTGATCAAATCCGCAGATCAAGAATCGGCCAACAGGAGA
CTCTATGATGAGATCATAAGCTCGGATCTGTTCAAGCTTTTGAAGAAAATGCACGGGAGCTCTTACGAAGCCTTTATGAA
AAGCAAGTTGATTCCAGTAACTGGAGACATTGGAGAAGACAATCTCGGGATCGAATCAGTAACATCAGCCAAGATTAGTG
GTGAGATTGATGTCATTATAAGCTGTGCTGGTCGCACGACATTTGACGATAGGTACGACTTTGCTTTGAATGTCAACGCT
CTTGGACCTGGTCGGCTTTTGAGATTTGGCAAGGGCTGCAAGAACCTGAAATTATTTCTCCACTTTTCAACTGCTTATGC
GACTGGTAAGAAAGAGGGAACAATACTAGAGACTCCTCTCTGCATTGGAGAAAACATAACTTGTGACTTGAACATCGAAT
CCGAGCTGAAACTAGCTTCAGAAGCGGTAAGAAAGTTACATGGCAATGAAGAAATAAAAAACCTGAAAGAACTTGGTATG
AAAAGAGCTCAACACTATGGCTGGGAAAACACTTACACATTCACAAAAGCTATGGGTGAGTCTGTAATTCACAACCAAAG
AGGAGATCTGCCTGTGGTGATCATAAGGCCTAGTGTTATAGAAAGCTCTTACAAGGAACCTTTCCCTGGCTGGCTCCAAG
GAATAAGGATGAGTGATCCAATTATCTTGGCCTATGGCAAAGGCCAAATTTCTGACTTCTGGGGAGATTATAAATCTTTA
ATGGACATTATACCTGTTGATATGGTTGTTAACGCCACAATAGCAGCCATGGCAAAACACAGTCGTGGTGTCTCCGAGCT
CAAAGTTTACAATGTCACTTCTTCATCTCATGCGAACCCCCTGCGAGTTGGCGAGTTGATGAACCTCTCTCATCAACATC
TGTGTGACTCTCCATTAACAGAAACATTTATGGAGCTAGAGCGTATGAAATTCCACAGTTCCTTAGAGGGTTTCACTTCT
TCTATATTCAACAGAATAGCAAAACATGAAAGAGGGGATGCAGATTCACATACCGCATTGAGCATGAAGGGAAAGAGGAA
GCTGGACTATTTTGTGTCCTTGGCAAGAACATATGAGCCTTACACGTTCTTTCAAGCTCGGTTTGACGACACCAATACAA
AGAGACTTATTCAGGAGCTGTCAGTGGAGGAGGGAAAGATGTTTGAGTTCGATATCAGTGGCATTGACTGGGAGCATTAC
ATTGTGAATGTTCATCTTCCAGGTCTCAAGAGGGAACTCTTTACGGAAAGATCCCGTTAA