Details for Chinese cabbage Locus Brara.I03896

Position : A09 ( 5`- 35586117 .. 35589011 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03896

Protein [Map View]
MELFIIFIFVPIFIFFIIPRQSSSDTGFKSYPIVGSIPGLVKNRHRFLDWTVETLSRCPTQTAVFRRPGKQQFVMTANPA
NVEYMLKTKFDNFPKGERFIEILEDFLGRGIFNSEGEMWWKQRKTARHEFSTKSLRDFVMTNVTLEINTRLVPVLAAAAA
TGKLLNLDDVLERFTFDNICKLAFNVDSACLGDDKAAGVEFMRAFDTASKIISQRFQSAFSYTWKIKKKLNIGSERLLRE
SIVTVHKFADDIVRHKIDQSNNNNNKNDDLLSRFISTEELNSPEKLRDNVIGFILAGRDTTSSALSWFFWLLSKHPHVEN
KIRQELNSIRARTGEAYGFEDLKLMNYLHAAITESLRLYPPIPLDTMSCLEDSVLPDGTFVGKAWGISYNAYAMGRMESI
WGKDCDRFDPERWIDETNGGFRGESPYKFPVFHAGPRMCLGKEMAYIQMKSIVSAVLDRFVVEVPGKNERPEILLSVTIR
IKGGLFVRVHERS*

DNA
ATGGAGCTTTTCATCATCTTCATCTTCGTCCCTATCTTCATCTTCTTCATCATCCCAAGACAATCTTCTTCAGACACAGG
TTTCAAGTCGTACCCTATTGTCGGAAGCATACCTGGACTTGTGAAAAACCGTCACCGTTTCCTCGACTGGACTGTAGAGA
CTCTGTCTCGATGCCCGACACAGACGGCGGTTTTCCGGCGACCAGGGAAGCAACAGTTCGTCATGACGGCGAATCCTGCC
AACGTAGAGTACATGCTCAAGACGAAGTTCGATAATTTCCCTAAAGGAGAGCGGTTCATCGAGATTCTTGAGGATTTTCT
CGGCCGCGGGATTTTCAACTCCGAGGGCGAGATGTGGTGGAAACAGAGGAAGACGGCGCGCCACGAGTTCAGTACTAAGT
CTCTTCGTGACTTCGTCATGACAAACGTCACACTCGAAATCAACACCAGGCTTGTTCCGGTGTTAGCAGCTGCAGCGGCC
ACCGGAAAATTGTTAAACCTGGACGACGTATTAGAAAGATTCACATTCGATAACATATGCAAGTTAGCATTCAACGTCGA
CTCCGCTTGCCTCGGAGACGACAAAGCCGCCGGTGTAGAGTTCATGAGGGCCTTTGATACGGCGTCCAAGATCATCTCGC
AACGGTTTCAATCAGCGTTTTCGTATACATGGAAGATCAAAAAGAAACTAAACATTGGATCAGAGAGACTTCTTAGAGAA
TCAATCGTGACCGTCCATAAATTCGCAGACGATATCGTGCGTCACAAGATTGATCAAAGTAACAACAACAACAACAAGAA
CGATGATTTGCTTTCAAGATTCATCAGCACCGAGGAGCTGAACTCGCCGGAGAAACTACGTGACAATGTCATTGGTTTCA
TCCTCGCGGGACGAGACACAACCTCCTCCGCTTTGAGCTGGTTCTTCTGGTTACTCTCGAAGCATCCACATGTAGAGAAC
AAGATCAGACAAGAGCTGAACTCGATCCGAGCAAGAACAGGGGAAGCTTATGGGTTTGAAGATCTTAAACTGATGAACTA
CCTGCACGCAGCGATAACCGAGTCACTAAGGCTGTATCCGCCTATACCGTTAGACACTATGAGTTGTCTTGAGGACAGTG
TATTGCCTGATGGGACGTTTGTAGGGAAAGCTTGGGGAATAAGTTATAACGCGTACGCGATGGGGAGGATGGAGAGTATT
TGGGGTAAAGATTGTGATCGGTTTGATCCAGAGAGGTGGATTGATGAAACAAATGGTGGGTTTAGAGGTGAGAGTCCTTA
CAAGTTTCCAGTGTTTCATGCAGGACCAAGGATGTGTTTAGGTAAGGAGATGGCTTATATTCAGATGAAATCTATAGTTT
CTGCGGTGCTGGATAGGTTTGTTGTCGAGGTCCCAGGGAAGAATGAGCGTCCTGAGATTTTATTGTCTGTGACGATTAGA
ATCAAAGGTGGTTTATTTGTTAGGGTACATGAAAGAAGCTGA