Details for Chinese cabbage Locus Brara.I03888

Position : A09 ( 5`- 35547716 .. 35550212 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03888

Protein [Map View]
MCEKARVIVRMLQGCNSMTKLRKIHSHVITNGLQHHPPIFDKLLRFCAVSVTGSLSHALLLFQHFDSDPSTTAWNYLLRG
FSVSSTPLSSLLFYNQMLLSTRPDIYTFSFALKACEKLRSVPKSLEIHGSVIRSGFHSDNIVSTGLVRCYSIGNIDIACK
VFDEMPVRDLVSWNAMISSLSHAGLHHQALSMHKRMEKEGVCIDAYTLVALLSSCAHVSALNMGVMLHRKACDVRCEGSV
YVGNALIDMYAKCGSLENAVSVFNGMRKRDVSTWNSMIIGYGVHGKGIEAISFFREMVTFGVRPNAITFLGLLLGCSHQG
LVKEGAEHFKMMSSEFCLSPNVKHYGCMVDLYGRAGEFDKALEMIHASSCHEDPVLWRTLLGSCKIHRNLELGEVAMKKL
VQLKAFNAGDYVLMTSMYSAANDAQGFASMRKLMRSHELRTVPGWSWIEIGDQVHKFVVDDKMHPESALIYSELKEVVRR
AVLAGYKPEVSNVTGSGFSDRCLGSAFHSEKLAIAYGLMRTPAGTALRITKNLRVCRDCHSFTKCVSKAFSRDIIVRDRV
RFHHFAGGLCSCNDYW*

DNA
ATGTGCGAGAAAGCTCGAGTGATAGTGAGAATGCTACAAGGCTGCAACAGCATGACCAAGCTCCGTAAGATCCATTCACA
CGTCATCACCAACGGTCTCCAACACCATCCTCCAATCTTCGACAAACTCCTCCGCTTCTGCGCCGTCTCCGTCACCGGCT
CTTTATCTCACGCTCTCCTCCTCTTCCAACACTTCGATTCTGATCCATCGACGACGGCTTGGAACTACCTCCTCCGCGGC
TTCTCCGTATCGTCAACTCCTCTCTCTTCCCTTCTCTTCTACAATCAAATGCTCCTCTCCACACGCCCCGACATCTACAC
TTTCAGTTTCGCCCTAAAGGCATGCGAGAAGCTCCGGTCGGTTCCGAAAAGCCTCGAGATTCACGGTTCGGTTATCCGGT
CTGGTTTCCACTCCGACAACATCGTCTCCACCGGTCTTGTTCGTTGTTACTCAATTGGAAATATTGACATTGCCTGCAAA
GTGTTCGACGAAATGCCTGTAAGAGACTTGGTCTCTTGGAACGCGATGATCTCTTCCCTTTCTCACGCAGGTTTACACCA
TCAGGCTCTGAGTATGCATAAGCGAATGGAGAAAGAAGGTGTGTGCATCGACGCTTACACGCTAGTTGCTCTGTTATCAT
CTTGTGCTCATGTAAGCGCTTTGAATATGGGAGTTATGCTACACAGGAAGGCCTGTGATGTTCGGTGTGAGGGAAGTGTA
TACGTGGGAAACGCTCTTATCGATATGTATGCTAAATGTGGTAGCCTTGAGAACGCTGTTAGTGTCTTCAATGGGATGCG
TAAGAGAGATGTGTCAACGTGGAACTCGATGATTATAGGGTATGGAGTTCATGGGAAAGGCATAGAGGCCATCTCGTTCT
TTAGAGAGATGGTGACTTTTGGGGTTAGACCCAATGCCATTACATTCCTAGGATTGTTGTTAGGTTGTAGTCATCAAGGT
CTGGTGAAAGAAGGAGCTGAGCATTTCAAAATGATGAGTTCTGAGTTTTGTCTGAGCCCTAACGTTAAACACTATGGATG
CATGGTGGATCTTTATGGACGAGCAGGGGAGTTCGATAAGGCGCTTGAGATGATACACGCGTCCTCCTGCCATGAAGATC
CTGTGTTGTGGAGAACCCTGCTTGGCTCTTGCAAGATCCACAGGAATTTGGAACTTGGTGAAGTGGCTATGAAGAAGTTG
GTGCAGCTCAAGGCTTTCAACGCAGGGGACTATGTGCTTATGACTTCGATGTATTCTGCGGCGAATGATGCTCAAGGCTT
TGCTAGCATGAGAAAGCTAATGAGAAGCCATGAGTTACGGACAGTTCCAGGTTGGAGTTGGATTGAGATTGGTGATCAAG
TTCACAAATTTGTGGTTGATGACAAAATGCATCCGGAGTCTGCACTTATTTACTCAGAACTAAAGGAAGTAGTTCGTCGC
GCCGTACTAGCTGGTTACAAGCCAGAGGTGTCAAACGTAACCGGTTCAGGTTTCTCTGATCGGTGTTTAGGATCTGCGTT
TCACAGTGAAAAGTTGGCTATTGCTTATGGATTGATGAGGACTCCTGCAGGAACAGCTCTCAGGATCACAAAGAATCTCA
GAGTTTGCAGAGATTGTCATTCGTTTACAAAATGTGTGTCGAAAGCATTCAGTAGGGATATTATTGTAAGGGATAGAGTT
CGGTTTCATCACTTTGCAGGTGGTCTTTGTTCTTGTAACGACTACTGGTGA