Details for Chinese cabbage Locus Brara.I03887

Position : A09 ( 5`- 35545598 .. 35547573 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03887

Protein [Map View]
MQSEESHELANEVSTKEESKETMKSQKADRKKKKLKEKLLKEATKAVNRGVCYLSRIPPHMDHVRLRQILSQFGEIDRIY
LAPEDPEAQVHRKKAGGFRGQLFSEGWVEFAKKSIAKRVADMLNGEQIGGKKKSAIYYDIWNIKYLSKFKWDDLTDEIAY
KSAIREQKLNMVMSAAKREKEFYLSKVEKSRAMTEIDERMKKKRKIQEESGSNAEPAQVFPPRVVRQFRQKTAIKNEVSQ
SKPGLSTDVLASVFGGS*

DNA
ATGCAGAGTGAGGAGTCTCACGAGCTTGCGAATGAAGTATCCACCAAGGAGGAGAGTAAGGAAACAATGAAGAGTCAAAA
GGCGGATAGAAAGAAAAAGAAGCTGAAAGAGAAGTTGCTCAAGGAAGCTACTAAGGCTGTCAATCGAGGAGTCTGCTACT
TGAGCCGCATCCCGCCGCACATGGATCACGTTAGACTTCGCCAGATCCTCTCTCAGTTTGGTGAAATTGATAGGATTTAT
CTTGCACCTGAAGATCCTGAAGCACAAGTTCACCGTAAGAAGGCTGGTGGGTTTCGTGGACAACTGTTTTCTGAAGGGTG
GGTTGAGTTTGCTAAGAAAAGTATAGCTAAGAGAGTCGCAGATATGCTTAATGGAGAACAAATAGGGGGAAAGAAGAAGT
CAGCTATATACTATGATATTTGGAACATCAAGTACTTGTCCAAATTCAAATGGGATGATCTCACCGATGAAATTGCATAC
AAAAGTGCAATAAGGGAACAGAAACTGAATATGGTTATGTCTGCTGCTAAGAGAGAGAAGGAATTTTATCTCTCTAAAGT
AGAGAAGTCTCGTGCCATGACCGAGATCGATGAACGAATGAAGAAGAAGCGAAAGATACAGGAAGAATCAGGCAGCAACG
CTGAACCAGCACAAGTCTTCCCGCCTAGGGTGGTTCGCCAGTTTAGACAGAAGACAGCAATCAAAAATGAGGTGTCTCAG
AGCAAACCTGGACTCTCCACAGATGTCCTAGCATCGGTTTTCGGCGGTTCTTAA