Details for Chinese cabbage Locus Brara.I03885

Position : A09 ( 5`- 35538010 .. 35541677 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03885

Protein [Map View]
MTKVCPEIEDMTLPEPVITVSADVSFASNHFPSYKLGPDNQIVEEPKEDEKGPSVQDTVEKESELLSDQHKRLSVRDLAS
KFDKNLAAAVTLADEAKLKEVASLEGHVMLKKLRDALEYMRGRMDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEV
KKLGNFLKQASEDAKKLVNHEKSFACAEIESARAVVLKLGEAFEEQERSSEASRAQGPDVEKLVEEVQEARQIKRMHHPT
KVMGMQHELHGLRSRLQEKYLNSIKLHQEIKRVEESKSCPFVLEGTQSLGSCLRIHVSSDDAIDLSNCSIQWYRAACETS
RREAISGANQSVYAPEPFDVGRILQADIISNGQKVTVTTDGPIDPDSCLQTRVESLMRKSNSEFNVVISQMNGQDYASRT
HVFTVGKTRIKLSRGWITKAREIYSTSMQLCGVRGNIKAPARALFWQPRKSLTFILTFESEQERNTAIVLARKYAFDCNV
TLLGPDD*

DNA
ATGACGAAAGTGTGTCCTGAGATCGAAGACATGACATTACCAGAACCAGTTATTACAGTATCAGCGGATGTGAGCTTCGC
TTCTAATCATTTTCCATCCTACAAACTAGGACCTGATAACCAGATTGTAGAGGAACCTAAAGAAGATGAGAAAGGTCCAT
CGGTTCAAGACACTGTCGAGAAAGAGAGCGAGTTGTTGTCTGATCAGCACAAGCGTCTTTCAGTGCGTGACCTCGCTAGT
AAATTTGACAAGAACTTGGCTGCAGCTGTTACTTTGGCTGATGAGGCGAAGTTAAAAGAGGTGGCTTCTTTAGAGGGACA
TGTTATGTTGAAGAAGCTAAGAGATGCTTTAGAGTACATGAGAGGACGCATGGACGGTCAAAACAAAGAAGATGTGGAGA
AAGCTATCTCTATGGTTGAAGCATTAGCTGTGAAGTTAACTCAGAATGAAGGTGAACTGATTCAAGAAAAGTTTGAAGTG
AAGAAACTTGGAAACTTCCTCAAGCAGGCTTCAGAAGATGCAAAGAAACTGGTAAACCATGAAAAATCATTTGCTTGTGC
TGAGATTGAAAGTGCGAGAGCCGTTGTGCTTAAACTTGGAGAGGCATTTGAAGAACAGGAACGGAGTTCTGAAGCTTCTA
GAGCTCAGGGACCGGATGTTGAGAAACTGGTTGAGGAGGTCCAGGAGGCTAGACAAATCAAACGTATGCATCACCCAACA
AAGGTGATGGGCATGCAACATGAGCTTCATGGTTTAAGAAGTCGACTCCAAGAGAAATATTTGAATTCTATTAAACTTCA
TCAAGAGATCAAGAGAGTTGAGGAATCAAAGTCGTGTCCATTTGTTCTGGAAGGCACACAAAGTCTCGGCTCTTGCTTAA
GAATCCACGTCTCCTCAGATGATGCTATAGATCTTTCAAACTGTTCAATCCAGTGGTACCGTGCAGCGTGTGAAACAAGT
AGAAGGGAAGCTATATCTGGTGCAAACCAATCAGTATATGCTCCAGAACCATTTGATGTTGGGAGGATATTACAGGCAGA
CATTATCTCAAACGGACAGAAAGTCACTGTTACAACAGATGGTCCAATTGATCCTGATTCTTGCTTGCAAACCCGCGTAG
AGTCTCTGATGCGAAAATCAAACAGTGAATTCAATGTGGTTATATCACAGATGAATGGACAAGACTATGCATCTAGAACT
CATGTCTTTACCGTTGGAAAGACAAGGATAAAGTTGTCTCGAGGATGGATCACAAAGGCGAGAGAAATATACTCAACATC
CATGCAGCTCTGTGGAGTTAGAGGCAATATCAAGGCTCCTGCAAGAGCATTGTTCTGGCAACCAAGAAAGAGTCTAACTT
TTATACTAACCTTTGAGTCAGAACAAGAACGTAACACAGCCATAGTCCTTGCTCGAAAATACGCTTTTGATTGCAATGTT
ACACTGCTTGGGCCAGATGATTAA