Details for Chinese cabbage Locus Brara.I03881

Position : A09 ( 5`- 35528315 .. 35529037 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03881

Protein [Map View]
MGNRCARTPSCRKLWSRICCCCSNINNTNGQARSKHGSKGMVYPVTRIEIWEEKVTEAKNNGKILVVNFNASWCVPCKKL
EPIFRELASRYPSMIFVTIDVEELAEFSNEWNVEATPTVVFLKDGRQMDKLVGAETSELQKKTAAAADL*

DNA
ATGGGAAATCGCTGTGCTAGAACTCCTTCTTGTAGAAAGTTATGGTCACGTATATGCTGCTGCTGCAGCAACATCAACAA
CACCAACGGTCAAGCCAGAAGCAAACATGGTTCCAAAGGAATGGTCTATCCTGTAACCAGGATCGAAATATGGGAAGAAA
AGGTCACAGAAGCTAAAAACAATGGCAAGATTCTTGTGGTGAATTTCAACGCTTCATGGTGTGTACCTTGTAAAAAGTTA
GAACCAATCTTCAGAGAACTTGCTTCTAGATACCCTTCAATGATATTTGTAACCATTGATGTTGAAGAGCTCGCTGAGTT
TAGTAATGAATGGAATGTGGAAGCTACACCAACAGTGGTGTTCCTTAAAGATGGGAGACAAATGGATAAACTCGTTGGTG
CTGAAACATCAGAACTTCAGAAGAAAACAGCTGCAGCTGCAGATCTCTAA