Details for Chinese cabbage Locus Brara.I03879

Position : A09 ( 5`- 35506110 .. 35507105 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03879

Protein [Map View]
MEEELHVLAVDDNLMDRKLVERILKISSCKVTTAENGIRALEYLGLGDSQQADSSSTNNVMKVNLIITDYCMPGMTGFEL
LKIVKESSNLKEVPVVILSSENIPTRINKCLASGAQMFMQKPLKLSDVEKLKCHLLNCRS*

DNA
ATGGAGGAAGAGCTCCATGTTTTAGCAGTAGATGACAATCTAATGGACCGTAAACTTGTGGAGAGAATCCTCAAGATCTC
TTCTTGCAAAGTGACAACAGCAGAAAATGGGATCAGAGCATTGGAGTACTTAGGCTTGGGAGATTCACAACAGGCTGATT
CATCAAGTACCAACAATGTTATGAAGGTGAATCTTATCATAACTGATTACTGTATGCCAGGGATGACAGGTTTTGAGCTG
CTCAAGATAGTAAAGGAATCGTCAAATCTAAAGGAAGTACCTGTTGTGATATTGTCATCAGAGAACATTCCTACTCGCAT
CAACAAATGTTTAGCCAGCGGAGCTCAGATGTTTATGCAGAAGCCACTGAAACTGTCGGATGTAGAGAAACTCAAGTGTC
ATCTCTTAAACTGCAGAAGCTGA