Details for Chinese cabbage Locus Brara.I03877

Position : A09 ( 5`- 35497402 .. 35498428 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03877

Protein [Map View]
MTSIRCRGGGGGGSACAVRSDRRTFTVRSSCVVPVLNRRNWADTGKVSMTAADMAPVKIGERKRGGSVVSRERIEQWLRD
SVVEIVKNLRESPLLVHLYAEANGGLSTTAKNPEAEDWKAMVGRWGRGEERTPEGVIFVEKLADDEGDDDHGGYNGGEGA
TSAWGIVAQGRGTDCGPVCYLLKTTRVGSGMGTVCTHFCLVKVKSFRETAMSQLNNSWLVQTGQ*

DNA
ATGACGAGTATTCGTTGCCGCGGAGGAGGAGGAGGAGGAAGCGCATGTGCCGTTCGTTCTGATCGGCGAACTTTCACCGT
TCGATCATCATGTGTGGTTCCGGTGCTTAATCGACGGAACTGGGCTGATACGGGGAAAGTTTCGATGACGGCGGCGGATA
TGGCGCCGGTGAAGATCGGTGAAAGGAAACGCGGCGGATCGGTTGTGTCGAGAGAAAGGATCGAGCAGTGGCTGAGAGAT
TCAGTTGTTGAGATCGTGAAGAATCTGAGAGAGTCGCCGTTGTTGGTGCACTTATACGCGGAGGCGAACGGAGGCTTGAG
TACGACGGCGAAGAATCCGGAGGCGGAGGATTGGAAGGCGATGGTGGGAAGGTGGGGTAGAGGAGAGGAAAGGACGCCGG
AGGGAGTGATCTTCGTGGAGAAGCTAGCTGACGATGAGGGAGATGATGATCACGGTGGATACAACGGTGGAGAAGGTGCA
ACAAGTGCTTGGGGGATAGTGGCCCAGGGAAGAGGAACTGATTGTGGACCGGTTTGCTACCTGTTGAAAACGACCCGGGT
TGGGTCGGGTATGGGGACGGTTTGCACACATTTTTGCTTGGTGAAGGTGAAGAGTTTTAGGGAGACGGCTATGTCACAGT
TGAATAACTCTTGGTTGGTGCAGACTGGTCAATGA