Details for Chinese cabbage Locus Brara.I03876

Position : A09 ( 5`- 35495036 .. 35496325 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03876

Protein [Map View]
MSIVVSIFLLTVFAMSLDVGTGKTTMEPCLESMKTASLPDLPYAYDALEPAISEEIMRLHHLKHHQTYVTNYNKALDHLR
SALSSGDHSSVVKLQSQIKFNGGGHVNHAIFWKNLAPVHEGGGKPPQDPLSSAIDAHFGSLEELMQKMNSEGAAVQGSGW
VWFGLDKELKRLVVETTANQDPLVTKGSHLVPLIGIDVWEHAYYPQYKNARAEYLKNIWTVINWKYASDIFEKHNRDLKE
F*

DNA
ATGAGCATCGTTGTTTCTATCTTCCTTCTTACTGTTTTTGCGATGAGCCTTGACGTCGGAACAGGAAAAACCACCATGGA
ACCGTGTCTCGAATCGATGAAGACCGCTTCACTACCTGATCTACCCTACGCTTACGATGCCCTAGAGCCAGCGATCAGCG
AGGAGATCATGCGCTTGCACCACCTGAAACACCACCAGACTTACGTTACTAATTACAACAAAGCCCTCGACCATCTCCGC
TCCGCCTTGTCCAGTGGTGATCACTCCTCCGTCGTCAAACTTCAGAGCCAAATCAAGTTCAACGGCGGAGGTCACGTTAA
CCATGCAATCTTCTGGAAAAACCTAGCCCCTGTTCATGAAGGAGGTGGTAAGCCACCTCAGGATCCTCTGTCTTCTGCGA
TAGATGCTCACTTCGGATCCTTAGAGGAGTTGATGCAAAAAATGAACTCTGAGGGTGCTGCTGTGCAGGGATCTGGATGG
GTGTGGTTTGGATTAGACAAAGAGCTAAAGAGACTTGTCGTTGAGACCACAGCTAATCAGGATCCATTGGTGACTAAAGG
ATCACACTTGGTTCCTCTGATCGGAATAGACGTATGGGAGCACGCCTACTATCCACAGTACAAAAATGCAAGAGCGGAGT
ACTTGAAGAACATATGGACTGTGATCAACTGGAAATACGCTTCGGACATATTCGAGAAGCACAACCGAGATCTAAAAGAG
TTTTAG