Details for Chinese cabbage Locus Brara.I03874

Position : A09 ( 5`- 35487833 .. 35489638 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03874

Protein [Map View]
MLLTLSPKTLSSSSPFPLHKSQIPRRKPPNPSRFNRRCNPISVKSEAQIERGLEFDPGATFFRHESARGRDLGVLSASLY
KRSNGSLRVLDAMCGCGIRSLRYLVEADADFVAANDANDENRRVITENLSKIERGEGDERRWVVTHMLANKAMIERYMVG
DFFDLIDIDSFGSDSAFLRDAFNALKLGGLLYLTSTDGYSSGGHRPYNSLAAYGAFIRPMPFGNEIGLRMLIGGAVREAA
LLGYHVTPLFSYYSYHGPVFRVLLRVHRGKLHEDRNYGFVTFCQLCGHSDTVRWDELGLLGCPCSDTKASSSLIVSGPMW
LGPLHDGSYVTEMLDLAKEWGWVSEGTGMDLERLLSIMIEESDPRLPPGYFKMDEMASRAKMNSPSLKKMMSALVKEGYA
VSRSHIISNGLKTDCPMSHFIKIAKDELQS*

DNA
ATGTTGTTAACCCTCTCTCCTAAAACCCTATCCTCTTCTTCTCCCTTCCCTCTTCACAAATCGCAAATCCCTAGACGCAA
ACCCCCAAATCCATCTCGATTCAACAGGAGATGCAATCCCATTTCCGTGAAATCGGAAGCCCAGATCGAGAGGGGACTCG
AATTCGATCCCGGGGCGACGTTCTTCCGCCACGAAAGCGCCAGAGGCCGCGACCTCGGCGTGCTCTCCGCTTCGCTCTAC
AAGCGATCCAACGGAAGCTTACGAGTCCTCGACGCCATGTGCGGGTGCGGAATCAGGTCGCTCCGTTACCTCGTGGAGGC
GGACGCCGATTTCGTGGCGGCTAACGATGCTAACGACGAGAATCGGAGGGTCATCACGGAGAATCTGAGTAAGATTGAGA
GAGGTGAAGGGGACGAGAGGAGATGGGTGGTGACTCATATGTTGGCGAACAAGGCGATGATTGAGAGGTATATGGTTGGT
GATTTCTTCGATTTGATTGATATTGATTCGTTTGGGAGTGATTCTGCGTTTCTGAGAGATGCGTTTAACGCGTTGAAGCT
GGGTGGGTTGCTTTATTTGACTTCAACGGATGGGTACTCTTCTGGTGGTCACAGGCCTTATAATTCGTTAGCAGCTTATG
GAGCGTTTATTAGGCCGATGCCGTTTGGGAATGAGATTGGGTTGCGGATGCTTATAGGTGGAGCGGTGAGAGAGGCTGCT
CTGCTTGGCTATCATGTTACGCCTCTTTTCTCATACTATTCTTATCATGGACCTGTGTTTAGAGTCTTGCTTCGGGTTCA
CCGTGGGAAGCTACACGAGGACAGGAACTATGGTTTTGTCACTTTCTGTCAGCTATGTGGCCATTCTGATACAGTGAGAT
GGGATGAACTTGGTCTGTTGGGATGTCCCTGCAGTGATACAAAGGCTTCTTCTTCATTAATAGTTTCGGGACCAATGTGG
CTTGGACCGCTTCATGATGGATCGTATGTTACCGAGATGCTGGATCTGGCTAAGGAATGGGGATGGGTGAGTGAGGGCAC
CGGCATGGATCTGGAGAGGCTTCTCAGCATAATGATAGAAGAGAGCGATCCGAGACTGCCACCCGGATATTTTAAGATGG
ATGAGATGGCGAGCCGTGCGAAGATGAACTCACCTTCGTTGAAGAAGATGATGAGTGCACTTGTTAAGGAGGGATACGCC
GTTAGCAGATCTCATATAATATCCAATGGTCTCAAAACAGATTGTCCCATGTCACATTTTATAAAGATTGCCAAAGATGA
ATTGCAGAGTTGA