Details for Chinese cabbage Locus Brara.I03871

Position : A09 ( 5`- 35471283 .. 35472241 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03871

Protein [Map View]
MGLRALPLQHSGGFVATTKVPISRTLPRISQKPRWVVVSAKQEKDEEKKKEDETSLFTRLTDALDFAQVRSEKDAELLYE
AREATKSGGKMNKEQYGALRRKIGGTYKDFFKSYVEVDGEYVEEGWVDKTCKVCKKDTRGEARQVDKLGRYVHVSCLQNP
SKPSGNFFTRLFIRDD*

DNA
ATGGGTCTAAGAGCACTGCCTCTTCAGCACAGCGGTGGGTTCGTCGCCACGACCAAAGTCCCGATCTCAAGAACCTTGCC
GAGGATAAGCCAGAAACCTAGATGGGTCGTCGTATCAGCAAAGCAAGAGAAAGATGAGGAGAAGAAGAAGGAAGACGAGA
CTTCGTTGTTCACTAGACTAACGGATGCGTTGGATTTCGCACAGGTTCGGTCGGAGAAAGACGCTGAGCTTCTCTACGAG
GCCCGTGAAGCCACCAAATCCGGTGGCAAGATGAACAAAGAACAGTATGGGGCTTTGAGAAGAAAAATAGGAGGAACATA
CAAGGACTTTTTTAAATCATACGTTGAAGTGGATGGAGAATATGTGGAAGAAGGATGGGTGGACAAAACATGTAAGGTAT
GCAAAAAGGACACAAGGGGTGAGGCAAGACAAGTGGACAAGTTAGGGAGATATGTTCATGTCTCCTGTCTACAAAATCCC
TCAAAACCTTCTGGAAATTTCTTCACCAGACTCTTCATAAGAGATGATTAA