Details for Chinese cabbage Locus Brara.I03870

Position : A09 ( 5`- 35466433 .. 35468525 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03870

Protein [Map View]
MAERRLQKNPAAEAIPGTPRIRDVRIVSGSEVTGLCSRGSSRVPFKLKDNYDGVGEYDLNKMEEKAAKLEKDLIMKELET
LDFLEALGSTKKIVKDLKLELQQQQPMRCMESPEHLRSEIKEMNHDERCHRTPMRSPDMIFMELKQANMNLGKTMDDLSM
IRSYVESLNMNTVEHKDFLGVASLAEELNSLRLKHDDEERFITKNVSVNPQCEQVKMVVETNDNKQSSTCLKTARMRLVA
ARKMEEAARAAEALAIAEMTMLSSAKDQDEFCFPEPPRSPLTLKEQMQEDISIEIMRKLEEANEEVKQSQQALETALNRV
EIANVKQLEAEDAVRQWNIESWKDQKAIKAKRSMKDDNIPRRSFLSHVSQHEPLDNLAKPMLKRNVSVGSGLNRKQVPNT
DEKHLRRKFRFMHNTVPEQTE*

DNA
ATGGCTGAGAGGAGGCTTCAAAAGAACCCTGCGGCGGAGGCCATTCCCGGTACACCGAGAATCCGGGATGTGAGAATCGT
ATCTGGGTCGGAGGTAACCGGATTATGTAGTCGTGGGTCTTCTCGGGTTCCATTCAAACTCAAAGACAATTACGACGGTG
TGGGAGAATATGACCTAAATAAAATGGAAGAAAAAGCAGCAAAGCTTGAGAAGGATCTAATCATGAAAGAGTTAGAAACT
CTAGATTTTCTAGAAGCTCTTGGATCAACAAAAAAGATCGTGAAAGACTTGAAGCTGGAGCTGCAGCAGCAACAACCCAT
GAGATGCATGGAGAGCCCTGAACATCTTCGTTCAGAAATCAAAGAGATGAACCATGATGAACGTTGCCATCGTACTCCCA
TGAGGTCTCCAGATATGATCTTCATGGAACTGAAGCAAGCCAATATGAATCTTGGTAAAACCATGGATGATCTTTCGATG
ATACGATCCTACGTTGAATCTTTGAATATGAATACGGTGGAACATAAAGATTTTCTTGGGGTGGCGTCTCTAGCTGAGGA
GCTCAACAGTTTGAGGTTAAAACATGATGATGAAGAGAGATTCATTACCAAGAATGTATCCGTGAACCCGCAGTGCGAAC
AAGTTAAGATGGTTGTTGAAACCAATGATAACAAGCAGAGCAGCACATGTCTTAAAACCGCAAGAATGAGATTGGTTGCT
GCAAGAAAAATGGAGGAAGCAGCTAGAGCAGCGGAAGCACTTGCGATTGCTGAAATGACCATGCTATCCAGTGCCAAAGA
CCAAGACGAGTTTTGCTTCCCAGAGCCACCAAGGTCACCTTTAACACTCAAAGAACAAATGCAAGAAGACATATCCATTG
AGATCATGAGGAAGCTGGAGGAAGCTAATGAAGAAGTTAAACAAAGCCAACAAGCCTTAGAAACTGCGTTAAACCGGGTG
GAAATTGCTAACGTGAAGCAACTTGAAGCAGAAGATGCGGTTCGCCAGTGGAACATTGAGTCATGGAAAGATCAGAAAGC
TATTAAAGCAAAGCGGTCCATGAAAGATGATAACATTCCTCGACGCTCCTTCTTGAGCCATGTGAGCCAGCACGAGCCGC
TTGACAATCTCGCTAAGCCGATGCTAAAACGTAATGTTTCAGTCGGCAGTGGCCTAAACCGGAAACAAGTCCCTAACACT
GATGAGAAACATTTGAGGAGAAAGTTTAGATTCATGCACAACACGGTTCCTGAACAGACAGAGTAA