Details for Chinese cabbage Locus Brara.I03868

Position : A09 ( 5`- 35457659 .. 35459395 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03868

Protein [Map View]
MEPHRPIARRLHRKPLGDCTNTISKTTKQQSSSSSSVVKFANPSLTSSLKRLVDQTSLKERNNNDVVDSSKAGPETASTS
LRAVTRRVSADLIFPATTPSRPSKPKDVEKTEAAPTRGRPVTRRVCTDLGFPASAPLRRQNSRSGEGVGSEKEVAEPYSV
YTSRRKASSGRKRSNHAVAANLRLDLISSPAGKKRRQANENTVKPSKLAPIKRQRTTKHEEDDLANGVSQDYIEKQRAYF
AEIDAFELAEEEVSDSDLD*

DNA
ATGGAACCTCACCGCCCAATCGCACGAAGACTACATCGCAAACCCCTCGGAGACTGCACCAACACCATCTCCAAAACCAC
CAAGCAACAGTCATCTTCTTCCTCCTCCGTCGTCAAATTCGCGAACCCGAGCCTCACTTCTTCTCTCAAGAGGTTAGTCG
ATCAAACCTCCCTCAAGGAGAGAAACAACAACGACGTCGTCGATAGCTCAAAAGCTGGTCCCGAAACCGCTTCCACGAGC
TTAAGGGCCGTGACTCGCCGTGTATCCGCCGATCTGATTTTTCCGGCGACTACGCCTTCTCGTCCTTCGAAACCCAAAGA
TGTTGAGAAAACAGAGGCTGCTCCCACGCGCGGAAGGCCCGTGACTCGCCGTGTGTGTACCGATCTGGGGTTTCCGGCGT
CTGCGCCTCTTCGTCGCCAAAACTCGCGCTCCGGCGAGGGCGTTGGTAGTGAGAAGGAGGTTGCTGAGCCTTACTCTGTT
TACACGTCTAGAAGGAAGGCTTCTTCTGGGAGAAAAAGGAGTAACCACGCAGTGGCTGCTAATCTTCGTCTTGACTTGAT
ATCAAGCCCTGCTGGGAAGAAAAGACGTCAAGCAAATGAAAACACAGTCAAGCCCTCGAAACTGGCTCCCATAAAGAGGC
AGCGAACAACAAAGCATGAGGAAGATGATTTGGCTAACGGAGTTTCTCAGGATTACATCGAGAAGCAGAGAGCTTACTTT
GCAGAGATCGATGCATTTGAGCTTGCAGAAGAAGAGGTATCTGATAGCGACTTAGACTAA