Details for Chinese cabbage Locus Brara.I03862

Position : A09 ( 5`- 35423801 .. 35426517 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03862

Protein [Map View]
MSPPIKTPLLPKQEPSSEKHGSTSGVVFNVSTSIIGAGIMSMPAAFKVLGVIPALLIITIIGWLSTISVGFLMKSTLAGE
ATTYAGVMKESFGKTGSVAVQVATMVATFGCMVIFSIIIGDVLSGNDNGGSVHLGVLQEWFGSHWWNTRIFALLFIYAFV
LLPLVLCRRVERLAFSSAISFLLAVLFVVISSVLAISALMKGQTKNPRLFPDLTDGGSFWNLFTASPVIVTAFTFHFNVH
PIGFELKDPLHVIPATKISVILCAAIYFATGLFGYLLFGDATMSDILVNFDQSSGSSIGSLLNDIVRLSYALHLMLVFPL
MNFSLRANLDELMFPTTKAPLAKDTKRFVGLTLALLICCFLSAIAVPDIWYFFQFLGSTTTVSIAFIFPAAIVLRNVHGV
STSREKIVAAIMLVLAVATSIVAISTNLYSLTSN*

DNA
ATGTCTCCTCCGATCAAAACTCCTCTCTTGCCAAAGCAAGAACCGTCTTCCGAGAAACATGGCTCTACCTCCGGCGTCGT
TTTCAACGTGTCGACGAGTATAATCGGAGCCGGTATAATGTCGATGCCGGCGGCGTTTAAGGTTCTCGGAGTAATCCCAG
CTCTTTTGATCATCACGATCATCGGTTGGCTCTCCACAATCTCTGTTGGGTTTCTTATGAAATCAACTCTCGCCGGAGAA
GCGACCACGTACGCCGGAGTTATGAAAGAGTCTTTCGGAAAGACAGGTTCTGTCGCTGTGCAGGTTGCTACAATGGTTGC
TACTTTTGGATGCATGGTTATCTTCTCGATCATTATAGGAGATGTGCTCTCAGGTAATGACAATGGAGGATCTGTTCATC
TTGGAGTTTTGCAAGAATGGTTTGGTTCTCACTGGTGGAACACGAGGATCTTCGCATTGTTGTTTATCTACGCCTTCGTC
TTGCTTCCATTGGTCTTGTGCAGACGTGTAGAAAGACTTGCGTTTAGTTCTGCGATATCCTTTCTTCTCGCTGTGCTATT
TGTCGTCATAAGCTCGGTGCTAGCGATCTCCGCCTTGATGAAAGGCCAAACAAAGAATCCGAGACTGTTTCCGGATTTAA
CCGATGGAGGATCGTTCTGGAATCTCTTCACAGCTTCTCCTGTTATAGTAACCGCCTTCACATTTCATTTCAACGTTCAT
CCAATTGGATTCGAGCTGAAGGATCCTTTACATGTGATCCCAGCAACTAAGATCTCTGTGATCTTGTGCGCTGCAATCTA
CTTCGCCACTGGACTCTTTGGATATCTCTTGTTTGGAGATGCAACAATGTCTGATATTCTAGTGAACTTTGACCAAAGTT
CAGGCTCTTCCATTGGTTCTCTTCTCAATGACATCGTCAGGCTCAGCTACGCGCTTCACCTCATGCTCGTCTTTCCTCTC
ATGAACTTCTCATTGAGAGCAAACCTCGACGAGCTCATGTTCCCAACAACGAAGGCTCCATTGGCAAAAGACACAAAAAG
ATTTGTTGGACTTACTCTAGCGTTACTGATCTGCTGTTTCTTGTCTGCGATCGCTGTGCCGGACATTTGGTACTTCTTTC
AGTTCTTGGGATCAACCACCACAGTTTCCATTGCGTTCATATTCCCAGCCGCCATTGTTTTAAGGAATGTCCATGGTGTA
TCGACCTCAAGGGAGAAGATTGTAGCTGCGATAATGCTGGTTCTTGCTGTTGCCACTAGCATCGTCGCCATCTCGACGAA
TTTATACAGTCTCACATCAAACTGA