Details for Chinese cabbage Locus Brara.I03859

Position : A09 ( 5`- 35416738 .. 35418823 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03859

Protein [Map View]
MGNAIRLLYRKCCSPTTDDKPHGVSALSRDLLSFETTSQVPEELGSYVVSSIKAQANWYGKILEAWKQAKPRPQTDEEAA
RLVITTLKGHKKADVEGLLSFYRLPSPGKLDEIPNESPVSVSEGLKFELLTLPVDQKSVADGDTVTVYVTSTDPIVSSTL
PKEVSLAAAKRAKARENKNYTEADALHKKIIASGYRMINVQNKEVLAKKFRIRLRGIDAPESKMPFGKESHDELLKMVEG
KSLKVLVYAEDRYGRCVGDIYCNGKFVQEVMLKKGLAWHYLAYDKRPELAKWENEAKQKRIGLWAAKNPEKPWEWRKNKR
GGN*

DNA
ATGGGCAACGCTATTAGGTTACTCTACCGGAAATGTTGCAGCCCCACGACGGACGATAAGCCTCACGGCGTTTCAGCTCT
TTCACGTGATCTCCTTAGCTTCGAGACCACTTCTCAGGTTCCTGAAGAGCTTGGAAGTTATGTTGTGTCTTCTATAAAGG
CTCAAGCAAACTGGTATGGAAAGATACTTGAGGCCTGGAAGCAAGCCAAGCCTCGGCCTCAGACCGATGAGGAAGCTGCA
AGGCTTGTTATCACGACTCTAAAGGGGCATAAGAAAGCTGATGTTGAGGGACTTTTGTCTTTCTATAGACTCCCTTCGCC
TGGTAAGCTCGATGAGATCCCTAATGAATCACCTGTGTCTGTATCCGAAGGACTTAAATTTGAGCTTCTAACGCTTCCGG
TGGATCAAAAATCTGTGGCAGATGGAGATACTGTTACTGTGTATGTTACTAGCACAGATCCTATTGTGTCATCTACACTT
CCTAAGGAAGTGAGTCTTGCAGCGGCTAAAAGAGCTAAAGCCCGAGAGAACAAGAATTACACAGAAGCAGATGCACTTCA
CAAGAAGATCATAGCTTCTGGTTACAGGATGATAAATGTTCAGAATAAGGAAGTTCTTGCTAAAAAGTTCAGAATAAGAC
TAAGGGGAATTGATGCACCTGAGAGTAAAATGCCTTTTGGAAAAGAGTCACATGATGAGCTACTTAAGATGGTTGAAGGT
AAAAGCTTGAAGGTGTTAGTCTATGCAGAGGATCGATATGGAAGATGTGTAGGAGATATATACTGCAATGGAAAGTTTGT
ACAAGAAGTTATGTTAAAGAAAGGTCTTGCTTGGCACTATCTAGCCTATGACAAGCGTCCAGAGCTTGCAAAGTGGGAAA
ATGAGGCTAAGCAGAAGCGTATTGGCTTGTGGGCGGCTAAAAATCCAGAGAAGCCATGGGAGTGGAGAAAGAACAAACGT
GGAGGAAATTAA