Details for Chinese cabbage Locus Brara.I03149

Position : A09 ( 5`- 30221703 .. 30223136 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03149

Protein [Map View]
MENRICDLPDDLLLLILILVPTKVAVTTTILSKRWRFVSKMLRLLEFNDDGNEKLGWFIDQSLQLHKAPKLRSLIVELGP
SCTVDVDVGKWIEYAVNRGVYVLDFKLLWTAKPTSFPKSLYTCDTIVDLSLSNEIFVDVSSQARLPSLLRLSLLHVVYKD
EDSLVRLLSSSPILNNLTVERHEEDNLTNFTVKVPSLQILYYVTTWRNKDGDDDRLTGSLVIDAPALTKFDIIDVWDYYC
LIENMPCLVEAYIGFVPNPNDKFLRNLVSVRHLLLCLTEPMVECCTATKFSWLIEFYFRPEESEPQSIAPSWNQPNSIPG
CLSSNLEIFGWVDYGGREDEKQLVTYILANAECLKKVEISFLDTSNLEEKQKELQSSPRISSSCQLLFPTQVEWDFS*

DNA
ATGGAAAACAGGATCTGTGATTTGCCCGATGATTTGCTCTTGCTGATCTTGATCCTCGTCCCAACAAAAGTCGCAGTCAC
CACTACAATCTTGTCTAAACGATGGCGTTTTGTCTCGAAGATGCTGCGTCTACTCGAGTTCAATGACGATGGCAACGAGA
AGCTGGGGTGGTTCATTGACCAGTCATTGCAACTCCATAAGGCACCGAAGTTGAGGAGTTTGATTGTTGAACTGGGTCCA
AGTTGTACTGTTGACGTTGATGTCGGAAAGTGGATTGAGTACGCAGTTAATCGTGGTGTGTACGTGTTAGATTTCAAGCT
CCTCTGGACCGCAAAACCCACAAGTTTTCCTAAGAGTCTTTACACATGCGACACAATCGTTGATTTATCTCTTTCCAATG
AGATTTTTGTTGATGTTTCCTCCCAGGCTCGCCTACCATCTCTCTTACGTCTGAGTCTTCTACATGTAGTGTACAAAGAC
GAAGACTCTCTTGTTAGGCTTTTATCAAGCTCCCCTATTCTCAATAACCTAACGGTTGAACGACATGAGGAGGACAACTT
GACAAACTTTACCGTGAAAGTGCCTTCCCTACAAATATTGTATTATGTGACTACTTGGCGCAACAAGGATGGTGATGATG
ATCGACTCACTGGGTCGTTGGTAATAGATGCCCCTGCATTAACAAAATTTGACATAATTGACGTCTGGGATTACTATTGT
TTGATAGAGAATATGCCTTGCCTTGTTGAGGCATACATAGGCTTTGTTCCTAATCCCAATGATAAGTTTTTAAGAAATCT
TGTATCTGTCAGACATCTTCTATTGTGTTTGACCGAACCAATGGTTGAGTGCTGTACCGCCACTAAGTTCTCTTGGCTCA
TAGAGTTCTATTTTCGTCCGGAAGAATCAGAACCCCAGAGTATCGCACCATCCTGGAACCAACCGAATTCTATTCCCGGA
TGCTTGTCGTCTAATCTAGAGATCTTTGGGTGGGTAGACTATGGAGGAAGAGAAGACGAGAAACAACTAGTCACATACAT
TCTAGCTAACGCAGAGTGTTTAAAGAAAGTGGAGATATCCTTCTTAGATACCTCTAATCTTGAAGAGAAACAAAAGGAGT
TACAATCTTCGCCTAGAATTTCATCATCATGTCAGCTTCTATTCCCCACTCAAGTGGAATGGGATTTTTCTTAA