Details for Chinese cabbage Locus Brara.I03147

Position : A09 ( 5`- 30214071 .. 30214550 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03147

Protein [Map View]
MIILEESTGTNPLFLVLLEGHPSASKASIDAVLTVDLAGCEGRCVICSDEWKAEDTVKEMPCNHRFH*

DNA
ATGATCATTCTTGAGGAGTCGACCGGAACGAACCCTCTGTTTCTCGTCCTACTTGAAGGTCATCCTTCAGCGTCCAAGGC
TTCCATTGATGCGGTGCTGACCGTTGATCTCGCCGGCTGCGAAGGAAGGTGTGTGATCTGTTCGGACGAATGGAAGGCGG
AGGATACGGTGAAGGAGATGCCGTGTAATCATCGGTTTCATTGA