Details for Chinese cabbage Locus Brara.I03146

Position : A09 ( 5`- 30207461 .. 30208874 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03146

Protein [Map View]
MWLSHLYRSLSLLMYTPVKLFGWTITSSLSLTNNQSATDNIEQASTSLQRSSDLTEESKETSENSEITTTTTTSEEKTTD
DLKKPDKILPCPRCNSSDTKFCYYNNYNVSQPRHFCRSCQRYWTSGGTMRIVPVGSGRRKNKGWVSTHHYMHTENTRSSE
KILSFDSSGEESLVTENGKNQSSDSVSRDFNNFQRFLPPQVTSSVSPPWPYPAFYHIPVYWGCTVPFWSTLQTSTCLGKR
TRDEASHVSVGENEDTSVRARLDSQSRSNNDEANVATKNRVFYPVPMKREKTQQFNLFVNESETKSGNNRFVPETYLNLQ
ANPAAMSRSMNFRESM*

DNA
ATGTGGCTCTCTCATCTCTACAGGTCCCTTTCTCTCCTGATGTATACCCCGGTCAAATTGTTTGGTTGGACAATCACATC
TTCTTTGTCCCTGACGAACAATCAATCTGCTACTGACAACATTGAACAAGCCAGTACAAGTCTTCAGAGATCATCTGATC
TCACCGAGGAGTCAAAAGAAACATCTGAGAACAGCGAGATCACAACAACAACAACTACATCGGAAGAGAAAACAACTGAT
GACTTGAAGAAACCAGACAAGATTCTTCCATGTCCACGATGCAACAGCTCGGACACCAAGTTCTGTTACTACAACAACTA
CAACGTTAGCCAGCCACGTCACTTCTGCAGAAGCTGCCAGAGGTATTGGACTTCCGGTGGAACCATGAGGATCGTCCCAG
TTGGTTCAGGCCGTCGTAAGAACAAGGGATGGGTTTCTACACACCATTACATGCACACGGAGAATACTAGATCCTCGGAG
AAAATTCTTAGCTTCGACTCTTCGGGCGAAGAGTCATTGGTTACTGAGAATGGTAAGAATCAATCAAGCGACTCTGTTTC
AAGAGATTTCAACAACTTCCAAAGATTTCTTCCTCCGCAAGTAACATCCTCTGTTTCGCCTCCTTGGCCTTACCCTGCTT
TCTACCACATCCCTGTCTACTGGGGCTGCACGGTACCATTTTGGTCTACTCTACAGACTTCTACGTGTCTAGGGAAAAGG
ACAAGAGACGAAGCTTCACATGTAAGTGTTGGAGAGAACGAAGACACTTCTGTAAGAGCAAGACTGGATTCACAATCTCG
AAGTAATAATGATGAAGCAAACGTAGCTACGAAGAATCGTGTGTTTTATCCAGTACCGATGAAACGCGAGAAGACACAGC
AGTTCAATTTATTCGTAAATGAGTCTGAAACAAAGAGCGGCAACAATAGATTCGTTCCTGAAACGTATCTAAACCTGCAA
GCAAACCCTGCAGCCATGTCAAGATCTATGAACTTCAGGGAGAGCATGTAA