Details for Chinese cabbage Locus Brara.I03145

Position : A09 ( 5`- 30197146 .. 30197783 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03145

Protein [Map View]
MIARLFPGRTDNSVKNHWHVIMARKYREHSSAYRRRKLMINNPLKPHLPNHRSPNCPSFISTKHYFTRPFHEFNLTHHLV
NHATMTADQNHLVLPFHCFQGYESTEAPTVVSMFGNQMMIEDNVGATSEALYNFPYVDSMSQEKGVPNEAMNLIGMEVVD
EEVAELKGKAATTFF*

DNA
ATGATTGCGAGGCTTTTTCCTGGTAGGACTGATAATTCCGTCAAGAACCATTGGCATGTTATCATGGCTCGTAAGTATAG
AGAACACTCCTCTGCTTACCGTAGGAGGAAGCTTATGATTAATAATCCACTTAAACCTCATCTTCCTAATCACCGTAGCC
CTAATTGCCCCTCTTTTATCTCCACTAAGCATTACTTTACACGGCCTTTCCACGAGTTTAATTTGACTCACCACCTGGTT
AATCATGCGACTATGACGGCTGACCAAAATCATCTTGTGTTGCCTTTCCATTGCTTTCAAGGTTATGAGAGCACTGAGGC
TCCAACGGTCGTGAGTATGTTTGGCAATCAAATGATGATCGAGGATAATGTTGGTGCCACGTCAGAAGCGTTATATAATT
TTCCGTACGTTGACTCAATGAGCCAAGAGAAAGGAGTGCCAAATGAAGCAATGAATTTGATTGGAATGGAAGTGGTAGAT
GAGGAAGTGGCGGAATTAAAAGGCAAAGCAGCAACCACATTTTTTTGA