Details for Chinese cabbage Locus Brara.I03143

Position : A09 ( 5`- 30163844 .. 30165428 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03143

Protein [Map View]
MEANVNKLHGTPSIVTASSTARRHRSSILSLHYRNKRVSPSVTRCSTTRSNETGQDSSLSTSSLKKGLVFDLGTDSWDSE
EVGSPVVKRFLSDNEERWYMWYHGSSSSEQNPVSDSVGLAVSNNGIHWERGKGKVESTDDVGLVMTPCEDWWAFDKANVR
PGEVVIMSSSKVRADSSVYWMYYTGYTTETVEFQSQGLTFELGNPERFEKASVFRSLPGLAISQDGRHWARIEGEHHSGA
LFDVGSEKDWDFLYIASPHVVFHGSGDLRMYYHSFDAKTGEFCIGMGRSREGIKWVKFGKILGGRKEGSVCFDEMGGRYP
CVTRNKRDGSYVMAYEGVDRNGKMSIGLAVSEDGIKDWRRVQDVGAVLDVGEGGAWDNEGVGCPYLIEMDGDTDHQWRLY
YRGVGNGGRTGIGLAVSEGNEITKFTKQTGICL*

DNA
ATGGAAGCTAATGTCAACAAACTCCATGGAACTCCCTCCATCGTCACCGCCTCTAGTACAGCTCGACGTCACAGATCATC
CATTCTCTCACTTCACTACCGGAACAAACGAGTTTCTCCGTCAGTCACAAGATGTTCCACCACCAGAAGTAACGAAACAG
GGCAAGATTCGAGCTTATCGACCTCTTCTTTGAAGAAAGGACTGGTTTTTGATCTGGGCACTGATTCGTGGGACAGCGAG
GAGGTCGGATCTCCTGTCGTGAAGAGATTTCTAAGCGACAACGAAGAGAGATGGTACATGTGGTACCATGGAAGCTCCTC
CTCAGAGCAAAACCCAGTTTCAGATTCTGTCGGATTAGCTGTTTCGAACAATGGGATTCACTGGGAAAGAGGGAAAGGGA
AAGTTGAGTCGACAGACGATGTGGGTTTGGTCATGACCCCGTGTGAAGACTGGTGGGCTTTCGACAAGGCTAACGTTCGG
CCCGGTGAAGTAGTGATAATGTCTAGCTCCAAAGTCAGAGCTGATAGCTCTGTTTACTGGATGTATTACACAGGCTACAC
GACCGAGACCGTTGAGTTTCAATCCCAAGGTTTGACCTTTGAGTTGGGGAATCCAGAAAGGTTCGAGAAAGCTAGCGTTT
TTAGGTCGCTTCCCGGGTTAGCGATTAGTCAAGACGGTAGGCACTGGGCTAGAATCGAAGGTGAGCATCATAGCGGTGCG
TTGTTTGATGTTGGGTCTGAAAAAGATTGGGACTTTCTATACATTGCATCACCGCATGTAGTGTTCCATGGAAGTGGGGA
TCTAAGGATGTATTACCATTCTTTCGACGCGAAAACCGGTGAGTTCTGCATTGGGATGGGGAGATCTAGGGAAGGGATCA
AGTGGGTGAAGTTTGGTAAGATCTTAGGAGGAAGAAAGGAAGGTTCAGTTTGCTTTGATGAGATGGGAGGAAGGTATCCT
TGCGTGACAAGGAACAAGAGAGATGGGAGTTATGTGATGGCCTATGAAGGTGTAGATAGAAATGGTAAGATGAGCATTGG
CTTGGCAGTTTCAGAAGATGGGATTAAGGATTGGAGACGGGTACAGGACGTGGGAGCAGTGCTTGATGTTGGTGAAGGCG
GTGCGTGGGATAACGAAGGGGTTGGGTGTCCTTATTTGATTGAGATGGATGGAGACACTGATCATCAGTGGAGGTTGTAT
TATAGAGGTGTTGGTAATGGTGGAAGAACAGGGATTGGGTTAGCTGTGTCTGAGGGAAATGAGATCACTAAGTTTACAAA
ACAGACAGGGATTTGCTTGTGA