Details for Chinese cabbage Locus Brara.I03138

Position : A09 ( 5`- 30145738 .. 30152035 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03138

Protein [Map View]
MREENDHGAEPRERTLGLTPTWSVATVLTVFVVVSLIVERSIHRLSNWLRKTKRKPLFAALEKMKEELMLLGFISLLLTA
ISSTIANICVSSSFYDNRFVPCSRSEIIEEHDSISSVKRTRLTRSTFFHILRRRLVGIGETTCSEGHEPFVSYEGMEQLH
RFIFIMAVTHVTYSCLTMLLAIVKIHRWRIWEDEAQMDRNDCLTVVAREKILRRQTTFVQYHTSAPLVKNRILVWVICFF
RQFGHSVVRPDYLTLRKGFIMNHHLTLTYDFHSYMIRSMEEEFQKIVGVSGPLWGFVVAFMLFNIKGSNLYFWLAIIPIA
LVLFVGAKLQHVIATLVLENAGITEYASGVKLRPRDELFWFKKPELLLSLIHFIQFQNAFELASFFWFWWQFGYNSCFLR
NHLLVYLRLILGFAGQFLCSYSTLPLYALVTQMGTNYKAALLPQRVRDTINGWGKATRRRRRHGLYGDDSTIRTETSTIA
SVEEYDHQKLDDVPETSPAQGTDHELELVKNWEASITVANENSSRVGTPLLQPCASTSSTTFSKLQTETTESLSRSSSLP
VKR*

DNA
ATGAGAGAAGAAAATGATCATGGAGCAGAACCAAGGGAGAGAACGCTGGGTCTAACACCAACTTGGTCCGTTGCTACAGT
TTTGACTGTCTTTGTAGTTGTTTCTTTGATCGTTGAGCGTTCCATTCATCGGCTAAGTAACTGGTTGCGGAAAACAAAGA
GGAAACCTTTGTTTGCTGCATTGGAGAAAATGAAAGAAGAGCTGATGCTGCTCGGATTCATATCTCTTCTTCTTACAGCT
ATCTCTAGCACAATAGCTAACATATGCGTTTCTTCAAGTTTCTACGACAACAGATTTGTCCCATGTTCCCGGTCTGAGAT
CATTGAGGAACATGATAGTATTTCATCTGTCAAACGGACTCGGTTGACGAGATCTACTTTCTTCCACATCTTGAGGAGAA
GATTGGTTGGCATTGGCGAGACTACTTGCAGTGAGGGACATGAGCCATTTGTTTCATATGAAGGCATGGAACAGTTGCAT
CGCTTCATATTTATAATGGCAGTCACACATGTAACTTACAGCTGCTTGACTATGCTCCTTGCAATCGTGAAGATTCATAG
ATGGAGGATCTGGGAAGACGAGGCTCAGATGGATCGAAATGATTGCTTAACAGTGGTCGCACGTGAAAAGATATTGAGAA
GGCAAACAACATTTGTCCAATATCATACATCTGCTCCTCTGGTCAAGAATAGAATACTTGTATGGGTGATATGTTTCTTT
CGGCAATTTGGACACTCCGTTGTTCGTCCTGACTATTTAACACTCCGCAAGGGATTCATCATGAATCATCACCTAACATT
GACATACGATTTTCATAGCTATATGATCCGCTCTATGGAGGAAGAGTTCCAAAAGATTGTCGGTGTCAGTGGGCCACTTT
GGGGCTTTGTAGTTGCTTTCATGCTTTTTAACATCAAAGGGTCAAATCTTTATTTCTGGTTAGCAATCATTCCAATAGCT
CTTGTTCTTTTCGTTGGTGCAAAGCTGCAACATGTAATTGCAACTTTAGTATTGGAGAACGCTGGGATAACAGAATATGC
TTCTGGTGTTAAATTGAGACCTCGTGATGAACTTTTCTGGTTCAAGAAACCAGAATTACTCTTATCCCTTATCCACTTCA
TTCAGTTTCAGAATGCCTTTGAGCTGGCTTCGTTTTTCTGGTTTTGGTGGCAATTTGGATACAACTCTTGCTTCCTTAGG
AATCATTTACTTGTCTACTTGCGATTAATTCTGGGGTTTGCTGGACAGTTTTTATGTAGCTACAGCACATTGCCACTCTA
TGCACTTGTCACTCAGATGGGAACAAATTACAAGGCAGCGTTGTTACCTCAGAGGGTAAGAGATACAATAAACGGTTGGG
GAAAAGCAACCAGAAGAAGAAGACGGCATGGGTTATATGGAGATGATTCGACTATTCGAACAGAAACAAGCACAATCGCA
TCAGTTGAAGAATACGATCATCAAAAGCTTGATGATGTTCCTGAAACCTCTCCAGCTCAAGGTACTGATCATGAGCTGGA
GCTTGTTAAAAACTGGGAAGCTTCTATCACAGTAGCTAATGAAAATTCTAGTCGGGTTGGAACACCCCTCTTGCAACCTT
GTGCGTCAACATCGTCAACGACTTTCTCAAAGTTACAGACAGAAACCACAGAATCACTTTCAAGGTCGTCCTCACTGCCA
GTGAAAAGATAA