Details for Chinese cabbage Locus Brara.I03137

Position : A09 ( 5`- 30142590 .. 30143771 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03137

Protein [Map View]
MVLRSENLWTFLITLAIISRVSQSLHFELRSGRTKCISEDIKSNSMTVGKYTVVNPNEAHPSPPSHKISIRVTSSYGNTF
HHAEDVDSGQFAFTAVEAGDYMACFTANGHKPEVTLSIDFDWRTGIHSKSWGSVAKKSQVEVMEFEVKQLIETVNSIHDE
MFYLRDREEEMQNLNRGTNSKMAWLSLLSLFVCLGVAGMQFMHLKSFLEKKKVI*

DNA
ATGGTTCTCCGATCAGAAAACCTCTGGACGTTCCTGATAACCCTAGCGATTATCTCCCGCGTATCTCAATCTCTCCACTT
CGAATTGCGATCAGGCCGAACAAAATGCATATCGGAAGACATCAAAAGCAATTCAATGACCGTCGGCAAATACACCGTCG
TCAACCCCAACGAAGCTCACCCTTCTCCTCCCTCTCACAAGATCTCCATAAGGGTGACATCGAGTTACGGGAACACGTTT
CATCACGCGGAAGACGTGGACTCGGGACAATTCGCGTTCACGGCGGTGGAAGCTGGAGACTACATGGCTTGTTTCACTGC
CAACGGTCATAAGCCTGAGGTGACGTTGAGTATCGATTTTGATTGGAGGACGGGTATTCATTCCAAGAGCTGGGGTAGTG
TCGCCAAGAAGAGCCAAGTCGAAGTCATGGAGTTTGAGGTTAAGCAACTGATTGAAACCGTCAACTCGATTCATGATGAG
ATGTTTTATCTCAGAGACAGGGAGGAAGAGATGCAGAATCTGAACAGGGGTACAAACTCCAAAATGGCTTGGTTGAGTTT
ACTCTCTCTTTTCGTATGCTTAGGAGTCGCTGGAATGCAGTTTATGCACTTGAAGTCGTTTCTGGAGAAGAAGAAAGTCA
TCTAA