Details for Chinese cabbage Locus Brara.I03135

Position : A09 ( 5`- 30118683 .. 30127505 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03135

Protein [Map View]
MAYDQSLHSPDNPHFFQPLLPGFHTHLNIPVAFFLKHVQGSNDQIKTAKLTTDASAKTWLVKVDGVRLTDGWEDFAVGHD
LRIGDITIFRHEGEMVFHVTAFGPSCCDIQYTSASSHSINDDSQDQTNNAGNSSGEKRKRVKKNPRTKEDSSSDHSQFVA
HVSPSSLSSDRLYIPTGFARSNGLDNMSGKEIIVLLNEEGRSWSLDMTCNKVGMQTFVRPGWRRFCAENGMKKGHHYTFK
LVRRSAPLIIRLSHAEHEPEPATESSLNHSYYVGSVSSNSLSTDKLYLQRHFVTANGLEKGLSEITLKNEWGGSWILGFR
HYEPQNHTYLGPGWKTFCQVNGIKAEDSFMFKLVETGDKPVLLLCTSNRGKTPLDCSEDRDDVDSLSSDTSSEDDSKEES
QESDKESIEDADRSQQCIVMEKENNSLRCICSSPYSKHRFVRLSLTQSALKTSVLYLPLAFTRMNCINKPIKIMLLGKDG
VKKQVVDLLKNKSTGAMRFGKGWREFCDAHGVKAWAFGSQSNFGFVHLGLSFSDLSKSALFSLYESLVWDRFRFYRIRVR
ISKSLKNRFFDLKVPGPVETATQEDRLVEKLKPELSNRTEKVYPFIERRYIIMRTSKGPMNPPELLCDLAKINETMSISE
LCLPELSRELIISAVIIVSLAQKVIISNPKTSQRTVVCGCGKSPAVSKRPTIENGGASGGEPEQSAHLAGQHMSSQHRWR
NEMEKVWMEEEAVSGEDLRTQSLESRSHSTKEHAERRSSGKEYEERRTRLTLLSGNPQISGQHKRRTLEPKRFETVAVMV
ETNNAAVASEMNGAAVAAEMNGTAAAMEREADLKRGIKGDGRRRRRRARSLPASTKLRRNGASISVAGRDELGRTSLHKY
LQRLFTKINGSKKQRNVILLDRHGFLDKTIKFLEKPLLPGFHTYLVLLTLFLCSKHVNIPVAFFSKHVEGSNDHIKTAKL
RTDASAKTWLVEMDGLKLTDGWEDFAVAHDLRIGDIIIFRHEGKMVFHVTAFGPSLCEFQYTSASSHNINDVSDDDHTNK
TGNSSGEKRKRVKKNPRTKEESSSDHSHFVAHVTPSSLSCDRLYVPKGFAMSNGLDNMSGKEIVLLNEEGKSWNLNITYN
ESGMHTFVRPGWRRFCAENGISQGHHCTFELVPKSAPPVLRLSRAEHVPKPAPESSLHHSYYVGSVSSNSLRIDKLYLQM
KFVTANGMKKGFSEIILKNEWGGRWSVRLRHYASSNHTYLGPGWKTFCQVNGIKAGDPFMFKLVETGDKPVLLLCSSNRG
ETPLECSEDSDDVNSLSSDTSSGDDSREESQESEEESLQDDSSSKDCVEMEKRKSSLRCKCSSSYSKHRFVRLTLTQNAL
KTSVQHLPLGFTRVNGINRSRKIMLLGKDGVKKWVVDLLKNKSTGAMRIRKGWRELCDAHGVKVGQSFLLELIWEDKEAI
PVLKFCTKL*

DNA
ATGGCTTATGATCAATCTCTTCACTCTCCGGACAATCCACATTTCTTCCAGCCTCTCCTTCCTGGCTTCCACACTCACCT
CAACATTCCTGTAGCTTTCTTCTTGAAGCACGTCCAAGGAAGTAACGACCAGATCAAGACTGCAAAACTGACAACAGATG
CGTCCGCTAAAACTTGGTTGGTGAAGGTAGACGGCGTGAGACTCACAGATGGTTGGGAAGATTTTGCAGTAGGGCATGAT
CTCCGGATAGGTGACATCACCATTTTCAGACATGAAGGAGAGATGGTGTTTCATGTCACAGCTTTCGGACCAAGTTGCTG
TGACATTCAATATACTTCAGCATCATCTCACAGCATCAATGATGATAGTCAAGATCAGACCAACAATGCTGGAAACAGTT
CAGGAGAGAAGAGAAAAAGAGTCAAGAAGAATCCAAGAACGAAAGAAGATTCTTCATCAGACCATTCTCAATTTGTGGCA
CATGTCTCACCCTCTAGTCTAAGTTCTGATCGACTGTATATACCAACGGGGTTTGCTAGGTCAAACGGTCTGGACAACAT
GAGCGGTAAAGAGATTATTGTTCTTCTTAACGAGGAAGGAAGATCATGGAGCTTAGATATGACATGCAACAAAGTAGGCA
TGCAGACTTTTGTAAGACCTGGTTGGAGAAGATTCTGTGCTGAAAATGGGATGAAAAAAGGTCATCACTATACGTTCAAA
CTGGTCCGAAGATCTGCACCATTAATCATCCGTTTGTCCCATGCAGAACATGAGCCAGAACCAGCTACAGAATCTTCATT
AAATCATTCTTATTATGTTGGATCTGTCAGTTCTAATAGCCTTAGTACTGATAAACTGTATCTTCAGAGACATTTTGTGA
CTGCAAATGGTCTAGAGAAAGGACTCAGTGAGATAACTTTAAAGAATGAATGGGGAGGAAGCTGGATTTTAGGTTTCAGA
CACTACGAACCACAAAACCATACTTATCTCGGACCAGGCTGGAAAACTTTCTGCCAAGTAAACGGGATCAAAGCTGAAGA
TTCCTTTATGTTTAAACTGGTTGAAACTGGGGACAAGCCTGTTCTCTTGTTGTGCACTTCCAACCGTGGCAAAACACCGT
TAGATTGTTCAGAAGATAGAGATGATGTAGACTCACTCTCCTCAGATACTAGCAGTGAAGATGACAGTAAAGAAGAATCC
CAAGAAAGTGATAAGGAGAGTATTGAAGACGCGGACAGGTCACAACAATGCATCGTGATGGAGAAAGAGAATAATAGCTT
GAGATGCATATGTTCATCTCCATATAGTAAACACCGTTTCGTGAGGTTATCTCTTACACAGAGCGCTCTTAAAACCTCTG
TACTGTACCTTCCGTTGGCTTTCACTCGGATGAACTGCATCAACAAGCCAATAAAGATAATGCTGTTAGGTAAAGATGGA
GTGAAGAAACAGGTGGTGGATCTTTTGAAGAACAAATCAACTGGAGCAATGCGATTTGGAAAAGGATGGAGAGAGTTCTG
TGACGCTCATGGTGTAAAGGCATGGGCATTCGGGTCCCAATCGAATTTCGGTTTTGTGCACTTGGGTCTCAGTTTTTCGG
ATTTATCAAAATCTGCCCTATTCAGTTTATATGAAAGTTTGGTTTGGGACCGGTTCAGGTTCTATCGGATTCGGGTTAGA
ATTAGTAAATCTTTAAAAAACCGTTTCTTCGATTTAAAAGTACCTGGTCCCGTAGAGACCGCTACACAAGAAGACAGACT
GGTAGAGAAACTAAAGCCAGAACTCAGCAATAGAACCGAGAAAGTATATCCTTTCATTGAAAGAAGATATATCATTATGC
GCACTTCAAAGGGACCAATGAATCCACCGGAACTCCTTTGCGACTTAGCCAAAATCAATGAAACCATGTCCATTTCTGAA
CTGTGTTTACCTGAGCTAAGCCGTGAGCTGATAATATCAGCAGTAATCATAGTGAGCCTGGCCCAAAAAGTTATCATTAG
CAACCCAAAGACAAGCCAACGAACGGTTGTATGCGGTTGTGGAAAGTCGCCGGCGGTATCCAAACGGCCAACGATTGAGA
ACGGGGGAGCATCAGGCGGTGAACCGGAGCAGTCAGCACATCTGGCGGGACAGCACATGTCTTCGCAGCACCGGTGGAGA
AATGAAATGGAAAAGGTTTGGATGGAAGAGGAGGCGGTTTCCGGCGAGGATCTACGAACACAGAGCCTTGAAAGTAGGAG
CCACAGCACCAAGGAACACGCAGAACGGAGGAGCAGCGGCAAGGAATACGAGGAGCGGAGGACCCGCTTGACATTGCTTT
CCGGGAATCCCCAGATAAGCGGACAGCATAAGAGACGCACGCTTGAACCCAAACGATTTGAAACAGTAGCAGTAATGGTG
GAGACAAACAACGCGGCAGTCGCGTCGGAGATGAACGGAGCAGCAGTCGCGGCAGAGATGAACGGAACAGCAGCAGCGAT
GGAAAGAGAAGCAGACTTGAAACGAGGCATCAAGGGAGACGGACGAAGACGACGCCGGCGAGCTAGGTCGCTGCCGGCGT
CGACGAAACTAAGAAGAAACGGCGCCTCGATTTCCGTGGCAGGGAGAGACGAGCTAGGGCGAACTTCTCTACATAAGTAT
TTACAAAGATTATTCACGAAGATCAACGGCTCTAAAAAGCAGAGGAATGTTATTCTATTGGATAGACATGGTTTTTTGGA
CAAGACGATAAAGTTTCTGGAAAAGCCTCTCCTTCCAGGCTTCCACACATACCTCGTACTCTTAACTCTTTTCTTGTGCT
CCAAGCACGTTAACATTCCTGTAGCTTTCTTCTCGAAACACGTTGAAGGAAGTAACGACCATATCAAAACTGCTAAACTG
AGAACAGATGCCTCAGCTAAAACATGGTTAGTGGAGATGGACGGCTTGAAACTCACAGATGGGTGGGAAGATTTTGCAGT
AGCGCATGATCTACGGATTGGTGACATCATCATTTTCAGACATGAAGGAAAGATGGTGTTTCATGTCACGGCTTTTGGAC
CAAGTTTATGTGAATTTCAATATACTTCAGCATCATCTCACAACATCAATGATGTCAGTGATGATGATCACACCAACAAA
ACTGGAAACAGTTCAGGAGAGAAGAGAAAGAGAGTCAAGAAGAATCCAAGAACGAAAGAAGAGTCTTCATCAGATCATTC
TCATTTTGTGGCACATGTCACACCCTCAAGTCTAAGTTGTGATCGACTGTATGTACCAAAGGGTTTTGCTATGTCAAACG
GTCTGGACAACATGAGCGGTAAGGAGATCGTTCTTCTTAACGAGGAAGGAAAATCATGGAATTTGAATATTACATACAAC
GAATCAGGCATGCATACATTTGTCAGACCTGGTTGGAGAAGATTCTGCGCTGAAAATGGGATAAGCCAAGGTCATCACTG
TACATTTGAACTGGTCCCAAAATCTGCACCACCAGTCCTTCGCTTGTCCCGTGCAGAACATGTTCCAAAACCAGCTCCAG
AATCTTCACTACACCATTCTTATTATGTGGGATCTGTCTCTTCTAATAGCTTAAGAATTGATAAACTGTATCTTCAGATG
AAGTTTGTGACTGCAAATGGTATGAAGAAAGGATTCAGTGAGATAATTCTAAAGAATGAATGGGGAGGAAGATGGAGTGT
ACGTTTGAGACACTACGCATCAAGCAACCACACTTATCTGGGACCTGGCTGGAAAACTTTCTGTCAAGTAAACGGGATCA
AAGCTGGAGATCCCTTTATGTTTAAACTAGTTGAAACTGGGGACAAGCCTGTTCTCTTGTTGTGCAGTTCCAACCGTGGG
GAAACGCCGTTAGAGTGTTCAGAAGATAGTGATGATGTAAACTCCCTCTCCTCAGATACTAGCAGCGGAGATGACAGTAG
AGAAGAATCCCAAGAAAGTGAAGAGGAGAGTCTTCAAGACGATAGCAGCTCGAAGGATTGCGTTGAGATGGAGAAAAGGA
AGAGTAGCTTGAGATGCAAATGCTCATCTTCATATAGTAAACACCGTTTTGTGAGATTAACTCTTACACAGAACGCTCTT
AAAACCTCTGTACAGCATCTTCCGTTGGGTTTCACGCGGGTGAATGGCATCAACAGGTCAAGAAAGATAATGCTGTTAGG
TAAAGATGGAGTGAAGAAATGGGTGGTGGATCTTTTGAAGAACAAATCAACTGGAGCCATGCGAATTAGAAAAGGATGGA
GGGAGTTGTGTGATGCTCATGGCGTAAAGGTAGGACAGTCCTTTCTGTTGGAACTCATTTGGGAGGATAAAGAAGCAATT
CCGGTGCTTAAGTTCTGCACCAAACTCTGA