Details for Chinese cabbage Locus Brara.I03134

Position : A09 ( 5`- 30115115 .. 30116332 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03134

Protein [Map View]
MDPAHNTSAAEIGGSNGNATVSDDSKESLDQVINSINKSLVVLHQLHLSLSSSLTPSSQLHLLPRLNSLVSELNSISKLS
EKCNIQIPMEVLSLIDDGKNPDEFARDVLNSCVARNQATKGKTDAFKELRKHILEELEETFPDEVDKYREIRATSAAEAK
RLAQSQTVLPNGDAKVKSEL*

DNA
ATGGATCCAGCACATAACACAAGCGCAGCAGAGATTGGTGGGAGCAATGGTAATGCAACTGTGTCTGACGATTCAAAGGA
GAGCCTGGACCAAGTCATCAACTCTATTAACAAGAGTTTGGTCGTCCTTCACCAGTTACACCTTTCCCTCTCTTCTTCTT
TGACTCCCTCTTCTCAGCTTCATCTCCTCCCCCGCCTAAACTCTCTTGTATCAGAGCTGAATAGCATCTCTAAGTTGTCT
GAGAAATGCAATATTCAAATCCCCATGGAGGTTCTTAGCTTGATTGATGATGGGAAGAACCCTGACGAGTTTGCAAGGGA
TGTTCTCAATAGCTGTGTTGCCAGAAATCAAGCTACAAAGGGCAAGACTGACGCTTTCAAGGAATTGAGAAAACATATAC
TGGAGGAGCTTGAGGAGACATTCCCTGATGAAGTTGACAAGTATAGAGAAATCCGTGCTACTTCTGCTGCTGAAGCCAAA
CGTCTGGCCCAATCGCAAACTGTGTTACCAAATGGGGATGCCAAGGTCAAGAGCGAGCTATAA