Details for Chinese cabbage Locus Brara.I03133

Position : A09 ( 5`- 30113803 .. 30114708 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03133

Protein [Map View]
MEEGRQKDLQLLEEIIDKGLKEKLLQTIASRPDTRHTFVDVGLGFYVEFTRQEALDYIPQREERVK

DNA
ATGGAGGAGGGACGTCAAAAGGACTTGCAGTTGTTGGAAGAAATCATTGATAAAGGTTTAAAGGAGAAGCTTTTACAGAC
TATTGCTTCACGGCCAGATACAAGGCACACATTCGTGGATGTAGGGCTGGGATTTTATGTGGAGTTCACCAGGCAAGAAG
CTCTTGACTATATTCCACAACGGGAGGAAAGAGTTAAA