Details for Chinese cabbage Locus Brara.I03131

Position : A09 ( 5`- 30103331 .. 30105014 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03131

Protein [Map View]
METESNPILRKTELKSYSHKHFHSTNALEILRESVRILRYNLGAFMLTAAVLICPVSAVLLPNFLVDHSLVNKLTVKLLL
VAKSSGLPLQPFVKHSCQKFAETAVSSAMCFPMFVTVSLLSKTAVVYSVDATYSREKVEINKFLVALKKLWKRVVYTYLW
VCILIVGCFTFFCVLLVSICSSFSVLGFSPDFNVYGAILVGLAFSIVFANAIIVCNTAVVISVLEDVSGAGALARASDLI
KGQVQVGLLIFLGSTLGLAFVEGLFDHRVKKVSYGDGSSRLWEGPLLVVMYSFVTLIDSMMSAVFYFSCRVYYSMEASSV
GEAQPIMMDTVEVVDT*

DNA
ATGGAGACGGAATCGAATCCCATTTTGCGGAAAACGGAGCTCAAGTCATACAGCCACAAGCACTTCCACTCTACCAACGC
GTTAGAGATCCTGAGAGAGTCTGTTCGAATCCTCCGGTACAATCTCGGTGCGTTCATGCTAACCGCTGCCGTTTTGATCT
GTCCCGTCTCCGCTGTCCTCTTACCGAACTTTCTAGTTGACCACTCGCTGGTGAACAAACTCACCGTGAAGCTCCTCTTA
GTAGCCAAGTCGAGCGGTCTCCCTCTCCAGCCTTTTGTCAAACACTCTTGTCAGAAATTCGCTGAAACCGCTGTTTCGTC
CGCGATGTGTTTCCCTATGTTCGTCACCGTGTCGCTCTTGTCTAAAACAGCTGTTGTTTACTCGGTGGACGCTACTTACT
CGAGGGAAAAGGTGGAAATAAACAAGTTCTTGGTTGCGTTGAAGAAGCTGTGGAAGCGAGTTGTGTACACTTACTTGTGG
GTTTGCATTCTGATCGTTGGCTGCTTCACTTTCTTCTGCGTTCTTCTAGTATCAATCTGCAGCTCCTTCTCTGTCCTCGG
CTTCTCTCCGGATTTCAATGTCTACGGAGCCATCTTAGTCGGTTTAGCGTTCTCCATCGTATTCGCCAACGCCATCATAG
TCTGCAACACCGCGGTGGTGATCTCGGTTCTTGAAGATGTTTCAGGGGCAGGAGCGTTGGCGAGAGCTAGTGATCTGATC
AAGGGGCAGGTTCAGGTGGGGCTGTTGATATTCCTCGGGTCGACTTTGGGGTTGGCGTTCGTGGAAGGGCTGTTTGATCA
CAGGGTGAAGAAGGTGAGTTATGGAGATGGGTCTTCGAGGCTGTGGGAAGGACCTCTACTCGTGGTGATGTATTCATTTG
TGACGCTTATAGATTCGATGATGAGTGCGGTGTTCTATTTCAGCTGCAGAGTTTATTATAGTATGGAAGCTTCTTCTGTA
GGTGAAGCTCAGCCAATAATGATGGATACTGTTGAGGTTGTGGATACTTAG