Details for Chinese cabbage Locus Brara.I03130

Position : A09 ( 5`- 30100928 .. 30103154 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03130

Protein [Map View]
MELDLPESPTRSVRCIVKLGGAAITRKNELEEIHDENLEAVACQLRQAMTEGSAPSKVIGMNWSKRPGSSEISCDVDDLG
DHDSSEFSKFVVVHGAGSFGHFQASRSGVHKGGLEKPIVKAGFVATRISVTNLNLEIVRALAREGIPTIGMSPFSCGWTT
SKRDVASADLSTVAKTIVSGFVPVLHGDAVLDNILGCTILSGDVIIRHLADHLKPEYVVFLTDVYGVFDRPPSENDAVLL
KEIAVGEDGSWKVVNPVMDLTNKKVQTSVAAHDTTGGMETKIAEAAMIAKLGIDVYIVKAATPHSQRALNGELRESVPDD
WLGTIIRFSK*

DNA
ATGGAGCTCGATCTTCCTGAGAGTCCGACCAGATCAGTTCGTTGCATTGTGAAACTTGGAGGTGCGGCGATTACACGGAA
GAACGAGCTGGAGGAGATTCACGATGAGAATCTGGAAGCTGTGGCGTGTCAGTTACGTCAGGCTATGACGGAGGGTTCGG
CTCCAAGCAAGGTTATTGGAATGAATTGGAGCAAGAGACCTGGAAGCTCTGAGATTTCTTGTGATGTTGATGACTTAGGG
GATCATGACTCTTCTGAGTTTAGCAAATTTGTTGTTGTTCACGGCGCAGGTTCCTTTGGACACTTTCAGGCAAGCAGATC
AGGCGTTCACAAAGGAGGACTTGAGAAACCTATTGTTAAAGCTGGTTTTGTTGCTACTCGCATATCTGTCACAAATCTTA
ATCTTGAGATTGTACGAGCACTTGCACGAGAGGGTATTCCTACAATCGGCATGTCTCCATTTTCATGTGGTTGGACAACC
TCCAAAAGAGATGTGGCTTCTGCGGATCTATCAACAGTAGCTAAAACAATCGTTTCAGGATTTGTCCCTGTTCTCCATGG
AGATGCAGTGCTAGACAATATACTGGGCTGCACCATATTGAGTGGTGATGTTATCATCCGTCATCTTGCAGATCATTTGA
AGCCAGAATATGTTGTCTTCCTCACAGATGTGTATGGCGTTTTCGATCGACCACCTTCAGAGAATGATGCTGTGCTCTTG
AAAGAGATCGCTGTTGGAGAAGATGGAAGCTGGAAGGTTGTGAATCCAGTGATGGACCTCACAAACAAGAAAGTTCAAAC
CTCTGTTGCTGCCCATGATACAACGGGTGGAATGGAAACAAAGATAGCAGAAGCTGCTATGATTGCGAAGCTCGGAATCG
ATGTCTACATTGTGAAGGCTGCGACTCCTCATTCACAGAGAGCACTCAACGGCGAATTGAGAGAGAGTGTACCTGACGAT
TGGTTAGGGACTATCATTAGATTCTCAAAGTAG