Details for Chinese cabbage Locus Brara.I03125

Position : A09 ( 5`- 30081693 .. 30082928 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03125

Protein [Map View]
MEKEFVCKFCNKKFPSGKSLGGHIRIHSPQSSVHSDGFNGKNNNSKKRLVDQRALASHNYEGEKKMVMEMDTQSASETTT
TSSGPAMIKRSKKQPSSESFSTVSWSSDPGIDQGSKDLMFLHLGRKDFNLPESSENNSEILETKSSSGELLKTPHKVAVG
DDSDDSDDNGSSDSDYFMSGPKKSDVSVGGSLRNTGVGSGFNSFKNGDELGVKEGGSKHELGKSKRVSPSYGSDSYEDKK
NSKFHRSSDGGMVKKASGGDKNSKGHECPVCFKVYSSGQALGGHKRSHTIANQAQQRAKRKAADMQFGLYLPAEEDSDDD
*

DNA
ATGGAGAAGGAGTTTGTGTGCAAGTTCTGTAACAAGAAGTTCCCTTCTGGGAAATCACTCGGAGGTCACATCAGGATTCA
TTCGCCTCAGAGTTCAGTTCATTCAGATGGTTTCAATGGCAAGAACAACAACAGCAAGAAGAGGTTGGTTGATCAGAGAG
CTCTTGCCAGTCACAACTATGAGGGTGAGAAGAAGATGGTGATGGAGATGGACACCCAATCTGCTTCTGAGACTACTACT
ACTTCCTCTGGTCCTGCAATGATCAAAAGATCCAAGAAGCAGCCCAGTTCTGAATCTTTTAGCACTGTGAGCTGGTCTTC
TGATCCTGGGATTGATCAAGGATCTAAGGATCTCATGTTTTTACATTTGGGTAGGAAAGACTTTAACTTGCCTGAGTCAT
CAGAGAACAACTCTGAGATTCTCGAAACCAAGTCATCTTCAGGGGAGCTGCTTAAGACACCACATAAAGTTGCTGTTGGT
GATGATAGTGATGATAGTGATGATAATGGTTCCTCTGATTCTGATTACTTCATGAGTGGACCAAAGAAGTCAGATGTCTC
GGTTGGTGGGTCTCTTAGGAACACTGGAGTTGGTTCTGGATTCAACAGCTTCAAGAACGGTGATGAGCTTGGGGTAAAGG
AGGGAGGATCAAAGCATGAGCTGGGCAAAAGCAAAAGAGTCTCGCCTTCTTATGGAAGTGATTCTTATGAAGACAAGAAA
AACAGCAAGTTTCATAGGTCCAGTGATGGTGGCATGGTTAAGAAGGCAAGTGGTGGAGACAAGAATAGCAAAGGCCACGA
GTGCCCAGTCTGCTTCAAGGTGTACAGTTCAGGACAAGCTTTAGGAGGTCACAAGAGATCACATACCATTGCGAATCAAG
CACAACAGAGGGCCAAACGCAAGGCAGCTGATATGCAATTCGGTCTCTATCTTCCTGCTGAGGAGGATAGTGATGATGAT
TGA