Details for Chinese cabbage Locus Brara.I03120

Position : A09 ( 5`- 30060021 .. 30062309 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03120

Protein [Map View]
MSFINSGEQERESFDGVSAEERKMADDEEPPMAVQIQPDIPTLSAEESSEAVSVGVTVITGYLGAGKSTLVNYILNGKHG
KKIAVILNEFGEEIGVERAMINEGEGGALVEEWVELANGCICCTVKHSLVQALEQLVQRKDRLDHILLETTGLANPAPLA
SILWLDDQLESEVKLDCIVTVVDAKNLRFQLNERRDSSSFPEAFNQIAFADTVIMNKVDLISPEESDELEKEIHSINSLA
NVIRSVRCQVDLSNILDCQAYDSTHVSRLESLLEANKSLTTTDLHDSGVRTLCISEPQPINLHKVRLWLEEILWDKKLDM
DVYRCKAVLNIQNSDQMHILQAVKEIYEIVPARKWSEEDNRVNKIVFIGHKLDEEALKIGLRECRP*

DNA
ATGAGTTTTATAAACTCTGGCGAACAAGAAAGAGAGTCTTTTGACGGCGTCTCTGCAGAAGAGAGAAAAATGGCGGACGA
TGAAGAACCACCGATGGCTGTTCAAATCCAACCTGATATTCCCACTCTCTCCGCGGAGGAATCAAGCGAGGCTGTTTCCG
TCGGTGTCACTGTCATCACTGGCTATCTCGGCGCCGGAAAGTCCACCCTTGTGAACTATATTCTGAACGGGAAACACGGG
AAGAAAATAGCCGTGATTCTGAATGAGTTTGGGGAAGAGATTGGAGTTGAGAGGGCTATGATCAACGAAGGTGAAGGAGG
TGCCCTTGTTGAAGAATGGGTCGAGCTTGCTAATGGCTGTATTTGCTGCACTGTCAAGCACAGTCTTGTTCAAGCTCTCG
AGCAGCTTGTTCAGAGGAAAGACAGGCTTGATCATATACTGCTGGAGACAACAGGTTTAGCAAATCCGGCTCCTCTGGCT
TCTATTCTTTGGCTGGACGACCAGCTAGAATCAGAAGTCAAGCTTGACTGCATTGTTACTGTCGTGGATGCAAAGAACCT
TCGGTTTCAGCTCAATGAGCGCCGTGACTCATCCTCATTTCCTGAGGCTTTTAACCAAATAGCATTTGCGGACACGGTGA
TAATGAACAAGGTTGACTTGATTTCTCCAGAGGAATCTGATGAACTGGAGAAGGAGATTCATTCCATCAATTCCCTCGCC
AATGTCATCCGTTCTGTCAGATGCCAAGTTGATTTGTCCAACATATTAGACTGCCAAGCATATGATTCAACCCATGTTAG
TCGGCTTGAATCCCTGCTAGAGGCAAATAAATCATTAACGACAACGGATCTTCACGATAGTGGAGTGAGGACTCTATGCA
TCAGTGAACCTCAACCTATTAATCTCCATAAGGTTCGTTTATGGCTTGAGGAAATTCTGTGGGACAAGAAATTGGATATG
GATGTATATCGTTGCAAGGCTGTATTAAACATTCAAAACTCAGACCAGATGCATATTTTGCAGGCCGTTAAAGAGATTTA
TGAGATAGTTCCAGCGCGAAAATGGAGTGAAGAAGATAATAGAGTGAACAAAATAGTGTTTATAGGACACAAACTGGACG
AAGAAGCTCTTAAAATCGGGTTAAGAGAGTGCAGACCCTGA