Details for Chinese cabbage Locus Brara.I03119

Position : A09 ( 5`- 30058276 .. 30059986 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.I03119

Protein [Map View]
MSIVVVPCRRMINIRNQTRRFLLLHRRFTTELTQLRTTITPVNEDHLLRVCTILYQQQNSPDSRLVSKLSSTEFQLTHDF
FLQVCNNFPLSWRPVHRFFLYSQTHHPDFSHTSVTSNKILGIVGKSRNMDLFWEFAQETGKRGLANDKTFRVVLQTLASA
REMKKCVSFFHLMNGFGYSYNVTTLNRAVETLCKEKLVEEAKYVVAKLRDCIEPDEVTYRTMIEGFCDVGDLVEAAKVWN
LMMDEGFEVDVQAGKKIMETLLKKNQFDEASKVFYVMVSKRGEGLDVSFYRVMIDWLCKNGRVDTARKLFDEMREREIQV
DNLTWASIIYGLLAKRRVAEAYKTVEAIENPDISIYHALIKGLVKIKRASEATEVFRMMIQRGCEPIMHTYLMLLQGHLG
RRGRKGPDPLVNFDTIFVGGMVKAGKRLEATKYIERTLKRGVEVPRFDYSKFLHCYSNEEGVVMFEEMAKKLREVGLFDL
ADIFQRYGEKMTTRERRRNREETSPVLPPLPYRCPVPT*

DNA
ATGAGCATCGTCGTCGTTCCTTGTCGGAGGATGATTAACATCAGAAACCAAACTCGGCGATTCTTACTCCTCCACCGTCG
ATTCACTACCGAGTTAACTCAACTTCGAACCACCATCACTCCAGTAAACGAAGACCATCTCCTCCGCGTCTGCACAATCC
TCTACCAACAACAAAACTCCCCCGATTCACGACTCGTCTCCAAACTCTCCTCCACCGAGTTTCAACTCACACACGACTTC
TTCCTCCAAGTCTGCAACAACTTCCCCCTCTCATGGCGCCCGGTCCACCGCTTCTTCCTCTACTCGCAGACCCACCACCC
AGACTTCTCCCACACCTCCGTCACTTCCAACAAGATCCTCGGAATCGTCGGGAAATCAAGAAACATGGACCTTTTCTGGG
AATTTGCTCAAGAAACCGGGAAGCGAGGATTAGCCAACGACAAGACGTTTCGCGTCGTGCTGCAAACGCTCGCTTCCGCT
AGAGAGATGAAGAAATGCGTCAGCTTTTTCCATCTGATGAACGGGTTTGGATACAGTTACAATGTCACAACGCTGAACAG
AGCGGTGGAGACTCTGTGTAAGGAGAAGCTTGTTGAAGAAGCTAAGTATGTGGTTGCTAAGCTGAGAGATTGTATCGAGC
CTGACGAGGTGACTTACAGGACGATGATTGAAGGTTTTTGTGATGTTGGTGATTTGGTTGAAGCTGCAAAGGTTTGGAAT
TTGATGATGGATGAAGGGTTTGAAGTGGATGTTCAAGCTGGGAAGAAGATTATGGAGACGCTTTTGAAGAAGAACCAGTT
CGATGAAGCTTCCAAGGTCTTTTACGTGATGGTGTCGAAACGAGGTGAGGGTTTGGATGTGTCTTTCTACAGGGTTATGA
TTGATTGGTTGTGTAAAAACGGAAGGGTTGATACTGCCCGTAAACTGTTCGATGAAATGCGTGAGAGAGAGATTCAGGTG
GATAACTTAACTTGGGCGTCGATAATCTACGGGCTATTAGCTAAACGAAGAGTTGCAGAGGCTTACAAGACGGTTGAGGC
GATTGAGAATCCGGATATTAGTATCTATCATGCTTTGATCAAAGGGTTGGTGAAGATTAAACGGGCGAGCGAAGCAACAG
AGGTTTTCAGGATGATGATACAAAGAGGATGCGAGCCGATAATGCACACGTATCTTATGTTGCTGCAAGGGCATTTAGGG
AGAAGAGGAAGGAAAGGACCAGACCCGTTGGTGAATTTCGATACTATATTCGTTGGAGGGATGGTTAAGGCGGGGAAACG
GTTGGAAGCTACTAAGTATATTGAGAGGACGTTGAAGAGAGGGGTTGAAGTTCCTAGATTTGATTATAGCAAGTTCTTGC
ATTGTTATTCTAATGAGGAAGGTGTGGTGATGTTTGAAGAGATGGCTAAGAAACTTAGAGAAGTGGGTTTGTTTGATTTG
GCGGATATATTCCAGAGATATGGAGAGAAAATGACTACGAGAGAGAGAAGGAGGAATAGAGAAGAAACATCCCCTGTTTT
GCCTCCTTTGCCTTACCGATGTCCAGTGCCAACCTAA