Details for Chinese cabbage Locus Brara.H02160

Position : A08 ( 5`- 19105800 .. 19108015 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H02160

Protein [Map View]
MAADPSGKMEERNNDGDHKMEEVLLPGFRFHPTDEELVSFYLKRKIQHNPLSIELIRQLDIYKYDPWDLPKFATGEKEWY
FYCPRDRKYRNSSRPNRVTGAGFWKATGTDRPIYSSEGNKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRMPSLSEPSPSS
KRFFDSPVSPNDSWAICRIFKKTNTTTLRAMPHSFVSSLPSETSIDTMSLSNTSHFSSEKILKTSSHFQVHHENMSSTTK
PSSSPTSHVATINPFSYLDFTSYEKTTNVFNPVSSLDQQYLTNLFLATQETQPQFPRLASSNEFPSFLLNTSSSDSAFLG
ECTSQIDLSVMLAQEQCPALVSLPQEYQEKGNGEIKSMGGCNEDHHNHCGTLMFDDTGPTVEENHRHHYQDMKHNMTLLE
SYYSSLSSSNGDLPVCFSTT*

DNA
ATGGCGGCTGATCCTTCGGGAAAAATGGAAGAGAGAAACAACGATGGTGATCATAAAATGGAGGAAGTATTGTTGCCCGG
GTTTAGGTTTCATCCAACCGACGAAGAGCTTGTAAGCTTCTACCTGAAGCGGAAGATTCAACACAATCCTCTCTCCATTG
AACTCATACGACAACTCGATATCTACAAATACGACCCCTGGGATCTTCCAAAGTTTGCGACGGGTGAAAAGGAATGGTAC
TTTTATTGTCCGAGGGACAGGAAGTATAGGAACAGTTCGAGGCCGAACCGAGTGACTGGAGCCGGTTTCTGGAAAGCCAC
GGGAACGGACAGGCCTATATACTCGTCGGAAGGAAACAAATGCATAGGTTTAAAGAAGTCACTAGTGTTCTACAAAGGAA
GAGCTGCAAAAGGAGTTAAGACTGATTGGATGATGCATGAGTTTCGTATGCCTTCGCTCTCGGAGCCATCTCCTTCTTCT
AAGAGGTTCTTTGATTCGCCTGTCTCTCCAAACGATTCGTGGGCTATATGCAGAATCTTCAAAAAGACAAACACAACGAC
CCTAAGAGCTATGCCTCACTCATTTGTTTCCTCGTTGCCATCAGAGACAAGCATAGACACAATGTCGTTATCAAACACAT
CACACTTTTCTTCGGAGAAGATCCTCAAAACTAGCTCTCACTTCCAGGTTCATCATGAGAATATGAGCAGTACTACCAAA
CCTAGTAGTAGTCCAACTTCTCATGTGGCCACTATAAATCCATTCTCTTACTTGGATTTCACTTCCTACGAGAAAACCAC
CAACGTTTTCAATCCGGTTTCATCTTTAGACCAGCAATACCTCACTAATCTCTTTCTTGCCACACAAGAAACACAACCTC
AGTTTCCAAGGCTCGCCTCATCTAATGAATTCCCCTCATTTCTCCTAAACACGTCATCGTCAGATTCTGCCTTCTTAGGA
GAATGCACAAGCCAAATCGACCTAAGCGTTATGTTGGCTCAAGAGCAGTGTCCAGCGCTTGTAAGCCTACCACAAGAGTA
TCAAGAGAAAGGAAATGGGGAAATAAAGAGCATGGGTGGTTGCAATGAAGATCATCATAATCACTGTGGCACACTAATGT
TTGATGATACTGGTCCAACCGTTGAAGAGAACCATCGTCATCATTATCAAGACATGAAACATAACATGACATTGTTGGAG
AGTTATTATTCCTCTTTGTCGTCAAGTAATGGCGATTTGCCAGTTTGTTTCTCCACAACTTGA