Details for Chinese cabbage Locus Brara.H02157

Position : A08 ( 5`- 19087584 .. 19088599 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H02157

Protein [Map View]
MATEQQAEVGRETSSASRRFSRNRDLYLFLPFLFSDQESSDGDHNVASWRERIILVNPFTQGMIVLEESSGLNPLLRDLL
ESREEGHPPASKASIDAMRVVDTDGWGGECVICLEEWKADETVKEMPCKHRFHGGCIEKWLGLHGSCPVCRYEMPIEGDE
VERKRSDGGEIWVMFGRSSSGHDGGNSDGNTAGSGGT*

DNA
ATGGCGACAGAACAACAAGCTGAAGTTGGAAGGGAGACCTCATCTGCTTCACGAAGATTTTCAAGGAACAGAGATTTATA
TCTCTTCTTGCCTTTCCTCTTCTCTGATCAAGAATCATCAGATGGAGACCACAACGTTGCTTCGTGGCGCGAGAGAATCA
TTCTTGTCAACCCTTTTACACAAGGAATGATCGTACTCGAGGAGTCATCAGGGTTAAATCCTCTGCTACGAGACTTACTT
GAGTCACGCGAGGAAGGTCATCCTCCAGCGTCAAAGGCTTCCATCGATGCGATGAGGGTCGTTGATACCGACGGCTGGGG
AGGAGAGTGTGTGATATGTTTAGAGGAATGGAAGGCGGACGAGACGGTGAAGGAGATGCCGTGTAAGCATAGGTTTCATG
GAGGATGCATAGAGAAATGGTTAGGGTTACATGGGTCGTGTCCTGTTTGTAGGTACGAGATGCCTATTGAGGGAGATGAG
GTTGAAAGGAAAAGAAGTGACGGGGGAGAGATTTGGGTTATGTTTGGTAGAAGTTCTTCTGGTCATGATGGTGGAAACAG
TGATGGTAACACTGCTGGATCTGGTGGCACATGA