Details for Chinese cabbage Locus Brara.H02154

Position : A08 ( 5`- 19082687 .. 19082968 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H02154

Protein [Map View]
MVLHCRNKGKDLGFKAICFDFRFHLNIRRTAVYTCTFSWHGNVKRFDIFRADRDDNPRSTCGICRECIWHISESGPCRMK
RDGGSPYCFPWAS*

DNA
ATGGTCTTGCACTGCAGGAACAAAGGGAAAGATTTAGGCTTTAAAGCGATATGTTTCGATTTCAGGTTTCATCTTAATAT
ACGCAGAACAGCCGTGTATACTTGCACTTTCTCGTGGCATGGAAACGTAAAGAGATTTGACATTTTTAGAGCTGATAGAG
ACGATAATCCAAGAAGTACGTGTGGTATATGCAGAGAATGTATTTGGCATATATCTGAGTCAGGTCCATGTCGTATGAAA
CGCGATGGAGGCTCTCCTTACTGTTTTCCATGGGCTTCTTAG