Details for Chinese cabbage Locus Brara.H02151

Position : A08 ( 5`- 19073854 .. 19075470 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H02151

Protein [Map View]
MFISEKQRWTDEVAAARREASSWDFPFNDINVQHHRRCNTSHEFDILKSPLGDNVEGSNNHNPNYSNNESGKKETTDSGQ
SWSSSSSKPSVLGRGHWRPAEDVKLKELVAIYGPQNWNLIAEKLQGRSGKSCRLRWFNQLDPRINRRAFTEDEEERLMQA
HRLYGNKWAMIARLFPGRTDNSVKNHWHVIMARKYREHSSAYRRRKLMINNPLKPQLSNHPSPNPNHHSFISTHHYFTQP
FHEFNLTHHLVNNASITPDHNQLVLPIHCFQGYESNETPMVVSMFGNQIMGGDNVDVMSEGLYEYPYIDSTSHEKGVPNE
PMSWIGMEGEDEEVVEKAKQQPHFFDFLGLGTA*

DNA
ATGTTTATCTCGGAAAAGCAACGGTGGACGGATGAGGTCGCCGCCGCGAGGAGAGAAGCTTCTTCTTGGGACTTCCCTTT
CAACGACATTAACGTTCAACATCATCGTCGCTGCAACACAAGTCATGAGTTTGATATCTTGAAGAGTCCTCTTGGAGATA
ACGTAGAAGGGAGTAATAATCATAACCCTAATTATAGTAACAATGAGAGCGGTAAGAAGGAGACGACAGATAGTGGACAG
TCTTGGTCTTCCTCGTCTTCAAAACCGTCGGTCTTGGGGAGAGGACACTGGAGACCAGCTGAGGATGTTAAACTCAAAGA
GCTTGTCGCCATTTACGGTCCACAAAATTGGAACCTCATAGCTGAAAAGCTTCAAGGAAGATCAGGGAAGAGCTGTAGAC
TTCGGTGGTTTAATCAATTGGACCCGAGGATAAACAGAAGAGCTTTCACGGAGGATGAAGAAGAGAGACTTATGCAAGCG
CATAGGCTTTATGGTAACAAGTGGGCAATGATTGCGAGGCTATTTCCTGGTAGGACTGATAACTCTGTCAAGAACCATTG
GCATGTTATCATGGCTCGTAAGTATAGAGAACACTCCTCTGCTTACCGTAGGAGGAAGCTCATGATTAATAATCCACTTA
AACCTCAGCTTTCTAATCATCCTAGCCCTAACCCTAATCACCACTCTTTTATCTCCACTCATCATTACTTTACTCAGCCT
TTCCACGAGTTTAATTTGACTCATCATTTGGTTAATAATGCGTCTATCACGCCTGACCATAACCAGCTTGTGTTGCCTAT
CCACTGTTTTCAAGGTTATGAGAGCAATGAGACTCCAATGGTTGTGAGTATGTTTGGCAACCAAATAATGGGCGGGGATA
ATGTTGATGTCATGTCAGAAGGGTTGTATGAATATCCTTACATTGACTCTACGAGCCACGAGAAAGGAGTGCCAAATGAG
CCAATGAGTTGGATCGGAATGGAAGGTGAAGATGAGGAGGTGGTGGAGAAGGCGAAGCAGCAACCACATTTTTTCGATTT
TCTTGGCTTGGGGACGGCATGA