Details for Chinese cabbage Locus Brara.H02149

Position : A08 ( 5`- 19047078 .. 19048651 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H02149

Protein [Map View]
MVLRPEYLCTFLLTIAILSHVSQPLHFELKSGKSKCISEDIKSNAMTVGKYTVVNPNEPHPAPQSHKINIRVTSSQGNTY
HHAEEVDSGQFSFTAVEGGEYSACFAAHDHKPDVTLSIDLEWGSGVHYKSLGSLAKKSKVEVMEFEVKALIETVNSIHDE
MFYLRDREEEMQDLNRATNSKMAWLGLLSLFVCLGVAGMQFMHLKTFFEKKKVI*

DNA
ATGGTTCTCCGACCAGAATATCTATGCACATTCCTCTTAACCATAGCCATCCTATCGCACGTTTCCCAACCCCTCCACTT
CGAGTTAAAATCAGGCAAATCAAAATGCATCTCGGAGGACATCAAAAGCAATGCAATGACCGTCGGAAAGTACACCGTCG
TCAACCCTAACGAACCTCACCCTGCTCCACAATCTCACAAGATCAACATAAGGGTGACGTCGAGTCAGGGGAACACGTAC
CATCACGCGGAGGAGGTGGACTCGGGGCAGTTCTCGTTCACGGCGGTGGAAGGTGGAGAATACTCGGCGTGTTTCGCTGC
TCACGATCATAAGCCTGACGTGACGTTGAGTATCGATTTGGAATGGGGAAGTGGTGTTCATTACAAGAGTTTGGGTAGTT
TGGCGAAGAAGAGCAAAGTCGAAGTTATGGAGTTTGAAGTAAAGGCTTTGATTGAAACCGTTAACTCGATTCATGATGAG
ATGTTTTATCTTAGAGACAGGGAGGAAGAGATGCAGGATCTGAACAGGGCTACAAACTCGAAGATGGCGTGGTTGGGTTT
GCTCTCTCTTTTTGTATGCTTAGGAGTTGCTGGGATGCAGTTTATGCACTTGAAGACGTTTTTTGAGAAGAAGAAAGTCA
TCTAA