Details for Chinese cabbage Locus Brara.H02147

Position : A08 ( 5`- 19040315 .. 19043276 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H02147

Protein [Map View]
MREVSIKTNNAMPFLRTRVERNLVDEEVKGNNSTDDMNLSDHNTSSENATKRQFPVFLLPNSTSQACNGPLPKGFGSKDG
DVFEVSPVKARRKMINLQLPAHEYLDTDETDDNTICAPYKRSKSGRGDDASHHINSSGSCLDVKSSNGLLADLNEPLTLQ
GSEPVPHNADVEGQSSQNGWMVLDAGHGGSTQSQRDLHIPSRSDNAVQPQRQSYPATDYSNVIFSRERAHREMEARSVNP
QASYDSYVESTVASSNAPRLHNDYRPDFIRPWSHLSSPWKNPRCIPDQHKEVNHLLKRDFDINLPCDDASVSVDQLGAKA
FGLKKEGENKAANVRHCFDLNACASEDDDVSGLHSSLRVKTKGTFSVDLEAPPTLQSAEEEDGDSSQDELIKGAAEAIVA
ISLPDHPNDAASYSSTDAASKSQLSWFADIITSCGDELERKIDGSPQEYSSGEIDYFEAMTLSLQPTKEEDYMPEPLVPE
NMSFEGTGLNKPRRGKARRGRPKRGDFQRDTLPGLSSLSRHEVAEDIQLFGGLMRLRASGWGKATRRPRRQRCPPATVIL
T*

DNA
ATGAGAGAGGTTTCAATAAAAACAAACAATGCGATGCCGTTTTTAAGAACCAGAGTTGAGAGGAATTTGGTGGATGAAGA
AGTAAAGGGAAATAACTCAACTGACGATATGAATTTGAGTGATCATAATACATCATCTGAGAATGCAACTAAAAGACAGT
TCCCTGTGTTTCTCTTACCAAACTCAACTTCACAAGCTTGTAATGGTCCTTTGCCAAAAGGGTTTGGTTCCAAGGATGGG
GACGTGTTCGAGGTTAGTCCTGTTAAGGCCAGGAGAAAAATGATTAATCTTCAGCTCCCTGCACACGAGTATCTTGATAC
GGATGAGACCGATGATAATACGATCTGCGCTCCGTATAAACGCTCTAAATCTGGAAGAGGGGATGATGCTTCTCATCACA
TCAACTCTTCAGGATCTTGCTTGGATGTGAAGAGCTCTAATGGCTTATTAGCTGACTTGAATGAGCCACTCACATTGCAA
GGTTCAGAACCTGTGCCTCACAATGCAGATGTTGAAGGGCAGTCTAGTCAAAATGGATGGATGGTCCTTGACGCAGGGCA
TGGCGGAAGCACTCAGAGTCAGAGAGACCTGCATATACCTTCCCGTTCTGACAATGCAGTTCAACCTCAGAGGCAGAGCT
ATCCAGCAACTGATTATAGCAATGTAATATTCTCCCGGGAAAGAGCACATCGTGAGATGGAAGCTCGTTCAGTGAACCCT
CAAGCTTCTTATGATAGCTACGTTGAATCAACTGTGGCATCATCTAACGCTCCAAGATTACACAATGACTACCGCCCTGA
CTTTATCAGACCATGGAGCCATCTGTCTTCACCATGGAAGAATCCTAGGTGCATCCCTGATCAGCATAAGGAAGTGAACC
ACTTGTTAAAGCGAGACTTCGATATCAACTTGCCATGTGATGATGCCTCGGTTTCTGTTGACCAGCTTGGTGCTAAAGCC
TTTGGTCTTAAAAAGGAAGGAGAGAACAAAGCTGCCAACGTAAGACACTGCTTTGATCTAAATGCATGTGCTAGTGAGGA
TGATGACGTTTCAGGCTTACATTCTAGTCTAAGAGTGAAAACAAAAGGAACTTTTTCGGTAGATTTGGAAGCTCCCCCAA
CTCTCCAGAGTGCAGAAGAAGAAGATGGAGATAGCTCGCAGGATGAACTCATCAAGGGAGCAGCAGAAGCAATAGTCGCC
ATTTCATTGCCTGATCATCCTAATGACGCAGCTTCTTATTCTTCAACGGATGCAGCTTCCAAAAGTCAGCTCTCTTGGTT
CGCAGACATTATCACTTCTTGCGGTGATGAGTTAGAAAGAAAGATTGATGGTTCTCCACAAGAGTATTCTTCTGGGGAGA
TTGACTACTTTGAAGCCATGACACTGAGTTTACAACCAACCAAGGAAGAAGACTACATGCCAGAGCCATTAGTCCCTGAG
AATATGAGCTTCGAAGGGACGGGCTTGAACAAGCCAAGAAGAGGAAAAGCAAGAAGAGGAAGACCGAAGAGGGGGGATTT
CCAGAGAGATACTCTCCCTGGACTCTCCTCTCTATCAAGGCACGAAGTCGCTGAAGATATACAGTTGTTTGGTGGGCTTA
TGAGACTAAGGGCTTCAGGATGGGGAAAAGCAACAAGAAGACCGAGGAGACAAAGGTGCCCTCCTGCAACTGTCATCTTA
ACATGA